BLASTX nr result
ID: Chrysanthemum22_contig00023149
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00023149 (434 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023736111.1| uncharacterized protein LOC111884013 [Lactuc... 56 1e-06 >ref|XP_023736111.1| uncharacterized protein LOC111884013 [Lactuca sativa] gb|PLY72048.1| hypothetical protein LSAT_2X125460 [Lactuca sativa] Length = 199 Score = 55.8 bits (133), Expect = 1e-06 Identities = 29/47 (61%), Positives = 34/47 (72%), Gaps = 3/47 (6%) Frame = -1 Query: 428 MMKFGLVDD---GDHTGSPTSPLCIGGGFKKGCRFMKVKKAMLSFVR 297 ++KFGL +D G + SPTS LC GGG KKG + KVKKAMLSFVR Sbjct: 148 VVKFGLEEDIASGAGSDSPTSTLCFGGGLKKGYKIKKVKKAMLSFVR 194