BLASTX nr result
ID: Chrysanthemum22_contig00023113
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00023113 (406 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AMR68991.1| DOF transcription factor 16, partial [Chrysanthem... 102 5e-24 >gb|AMR68991.1| DOF transcription factor 16, partial [Chrysanthemum x morifolium] Length = 233 Score = 102 bits (253), Expect = 5e-24 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = -2 Query: 405 QEDETISKVGYSESSNVGVEECGLFDESYWWNNNNDYHQLDYFLS 271 QEDETISKVGYSESSNVGVEECGLFDESYWWNNNNDYHQLDYFLS Sbjct: 189 QEDETISKVGYSESSNVGVEECGLFDESYWWNNNNDYHQLDYFLS 233