BLASTX nr result
ID: Chrysanthemum22_contig00023011
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00023011 (390 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|OTF85602.1| putative protein phosphatase 4 core regulatory su... 56 1e-06 >gb|OTF85602.1| putative protein phosphatase 4 core regulatory subunit R2 [Helianthus annuus] Length = 425 Score = 56.2 bits (134), Expect = 1e-06 Identities = 34/68 (50%), Positives = 40/68 (58%), Gaps = 2/68 (2%) Frame = -2 Query: 203 FIMDTQTTETADNSPVVPAXXXXXXEPLDQSTSPVAA--QPQSIETLEQSPIPETNMQTA 30 +IM+TQ TET ++SPV+ E LDQST PV Q Q+ ETLE SP NM A Sbjct: 61 YIMETQATETTESSPVLLVTSTETTETLDQSTPPVVVVDQTQTTETLEPSPPVVANMPPA 120 Query: 29 ETSLPNVT 6 E S P VT Sbjct: 121 EVSPPQVT 128