BLASTX nr result
ID: Chrysanthemum22_contig00022782
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00022782 (538 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010474550.1| PREDICTED: chlorophyll a-b binding protein 3... 76 1e-14 gb|PNX55942.1| chlorophyll a-b binding protein, partial [Trifoli... 76 2e-14 ref|XP_017620673.1| PREDICTED: chlorophyll a-b binding protein 3... 75 8e-14 dbj|BAT81535.1| hypothetical protein VIGAN_03127900 [Vigna angul... 73 8e-14 ref|XP_009127100.1| PREDICTED: chlorophyll a-b binding protein 3... 74 9e-14 emb|CAA43802.1| LHC II Type III chlorophyll a /b binding protein... 76 1e-13 gb|ABK96657.1| unknown [Populus trichocarpa x Populus deltoides] 76 2e-13 gb|KOM43886.1| hypothetical protein LR48_Vigan05g149100 [Vigna a... 74 2e-13 gb|PIA54982.1| hypothetical protein AQUCO_00800013v1 [Aquilegia ... 76 2e-13 ref|XP_002317529.2| hypothetical protein POPTR_0011s12680g [Popu... 76 2e-13 emb|CDY14320.1| BnaA10g07350D [Brassica napus] 76 2e-13 emb|CDY18320.1| BnaC09g30700D [Brassica napus] 76 2e-13 emb|CDY52238.1| BnaC02g44590D [Brassica napus] 76 2e-13 gb|ABF13305.1| chloroplast chlorophyll a/b binding protein, part... 74 2e-13 gb|KYP44193.1| hypothetical protein KK1_034357 [Cajanus cajan] 76 2e-13 gb|KVI10519.1| Chlorophyll A-B binding protein [Cynara carduncul... 76 2e-13 ref|XP_013464782.1| light-harvesting complex I chlorophyll A/B-b... 76 2e-13 gb|PNT59393.1| hypothetical protein POPTR_001G407100v3 [Populus ... 76 2e-13 pdb|5XNL|3 Chain 3, Structure Of Stacked C2s2m2-type Psii-lhcii ... 76 2e-13 gb|PIA54983.1| hypothetical protein AQUCO_00800013v1 [Aquilegia ... 76 2e-13 >ref|XP_010474550.1| PREDICTED: chlorophyll a-b binding protein 3, chloroplastic-like [Camelina sativa] Length = 115 Score = 75.9 bits (185), Expect = 1e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 1 PSYLTGEFPGDYGWDTAGLSADPEAFAKNRALEV 102 PSYLTGEFPGDYGWDTAGLSADPEAFAKNRALEV Sbjct: 64 PSYLTGEFPGDYGWDTAGLSADPEAFAKNRALEV 97 >gb|PNX55942.1| chlorophyll a-b binding protein, partial [Trifolium pratense] Length = 131 Score = 75.9 bits (185), Expect = 2e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 1 PSYLTGEFPGDYGWDTAGLSADPEAFAKNRALEV 102 PSYLTGEFPGDYGWDTAGLSADPEAFAKNRALEV Sbjct: 62 PSYLTGEFPGDYGWDTAGLSADPEAFAKNRALEV 95 >ref|XP_017620673.1| PREDICTED: chlorophyll a-b binding protein 3, chloroplastic, partial [Gossypium arboreum] Length = 140 Score = 74.7 bits (182), Expect = 8e-14 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = +1 Query: 1 PSYLTGEFPGDYGWDTAGLSADPEAFAKNRALEV 102 PSYLTGEFPGDYGWDTAGLSADPEAFA+NRALEV Sbjct: 3 PSYLTGEFPGDYGWDTAGLSADPEAFARNRALEV 36 >dbj|BAT81535.1| hypothetical protein VIGAN_03127900 [Vigna angularis var. angularis] Length = 74 Score = 72.8 bits (177), Expect = 8e-14 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = +1 Query: 1 PSYLTGEFPGDYGWDTAGLSADPEAFAKNRALEVT 105 PSYL GEFPGDYGWDTAGLSADPEAFAKNRALE + Sbjct: 26 PSYLNGEFPGDYGWDTAGLSADPEAFAKNRALEAS 60 >ref|XP_009127100.1| PREDICTED: chlorophyll a-b binding protein 3, chloroplastic-like [Brassica rapa] ref|XP_022556829.1| chlorophyll a-b binding protein 3, chloroplastic-like [Brassica napus] Length = 132 Score = 74.3 bits (181), Expect = 9e-14 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = +1 Query: 1 PSYLTGEFPGDYGWDTAGLSADPEAFAKNRALE 99 PSYLTGEFPGDYGWDTAGLSADPEAFAKNRALE Sbjct: 64 PSYLTGEFPGDYGWDTAGLSADPEAFAKNRALE 96 >emb|CAA43802.1| LHC II Type III chlorophyll a /b binding protein, partial [Brassica napus] Length = 202 Score = 75.9 bits (185), Expect = 1e-13 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 1 PSYLTGEFPGDYGWDTAGLSADPEAFAKNRALEV 102 PSYLTGEFPGDYGWDTAGLSADPEAFAKNRALEV Sbjct: 64 PSYLTGEFPGDYGWDTAGLSADPEAFAKNRALEV 97 >gb|ABK96657.1| unknown [Populus trichocarpa x Populus deltoides] Length = 224 Score = 75.9 bits (185), Expect = 2e-13 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 1 PSYLTGEFPGDYGWDTAGLSADPEAFAKNRALEV 102 PSYLTGEFPGDYGWDTAGLSADPEAFAKNRALEV Sbjct: 23 PSYLTGEFPGDYGWDTAGLSADPEAFAKNRALEV 56 >gb|KOM43886.1| hypothetical protein LR48_Vigan05g149100 [Vigna angularis] Length = 145 Score = 73.9 bits (180), Expect = 2e-13 Identities = 32/39 (82%), Positives = 35/39 (89%) Frame = +1 Query: 1 PSYLTGEFPGDYGWDTAGLSADPEAFAKNRALEVTKLLF 117 PSYLTGEFPGDYGWDTAGLS DPEAFAKN+ALEV+ + Sbjct: 87 PSYLTGEFPGDYGWDTAGLSVDPEAFAKNKALEVSHFAY 125 >gb|PIA54982.1| hypothetical protein AQUCO_00800013v1 [Aquilegia coerulea] Length = 231 Score = 75.9 bits (185), Expect = 2e-13 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 1 PSYLTGEFPGDYGWDTAGLSADPEAFAKNRALEV 102 PSYLTGEFPGDYGWDTAGLSADPEAFAKNRALEV Sbjct: 30 PSYLTGEFPGDYGWDTAGLSADPEAFAKNRALEV 63 >ref|XP_002317529.2| hypothetical protein POPTR_0011s12680g [Populus trichocarpa] gb|PNT13150.1| hypothetical protein POPTR_011G126700v3 [Populus trichocarpa] Length = 231 Score = 75.9 bits (185), Expect = 2e-13 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 1 PSYLTGEFPGDYGWDTAGLSADPEAFAKNRALEV 102 PSYLTGEFPGDYGWDTAGLSADPEAFAKNRALEV Sbjct: 30 PSYLTGEFPGDYGWDTAGLSADPEAFAKNRALEV 63 >emb|CDY14320.1| BnaA10g07350D [Brassica napus] Length = 234 Score = 75.9 bits (185), Expect = 2e-13 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 1 PSYLTGEFPGDYGWDTAGLSADPEAFAKNRALEV 102 PSYLTGEFPGDYGWDTAGLSADPEAFAKNRALEV Sbjct: 64 PSYLTGEFPGDYGWDTAGLSADPEAFAKNRALEV 97 >emb|CDY18320.1| BnaC09g30700D [Brassica napus] Length = 234 Score = 75.9 bits (185), Expect = 2e-13 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 1 PSYLTGEFPGDYGWDTAGLSADPEAFAKNRALEV 102 PSYLTGEFPGDYGWDTAGLSADPEAFAKNRALEV Sbjct: 64 PSYLTGEFPGDYGWDTAGLSADPEAFAKNRALEV 97 >emb|CDY52238.1| BnaC02g44590D [Brassica napus] Length = 234 Score = 75.9 bits (185), Expect = 2e-13 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 1 PSYLTGEFPGDYGWDTAGLSADPEAFAKNRALEV 102 PSYLTGEFPGDYGWDTAGLSADPEAFAKNRALEV Sbjct: 64 PSYLTGEFPGDYGWDTAGLSADPEAFAKNRALEV 97 >gb|ABF13305.1| chloroplast chlorophyll a/b binding protein, partial [Phaseolus vulgaris] Length = 134 Score = 73.6 bits (179), Expect = 2e-13 Identities = 33/34 (97%), Positives = 33/34 (97%) Frame = +1 Query: 1 PSYLTGEFPGDYGWDTAGLSADPEAFAKNRALEV 102 PSYL GEFPGDYGWDTAGLSADPEAFAKNRALEV Sbjct: 7 PSYLKGEFPGDYGWDTAGLSADPEAFAKNRALEV 40 >gb|KYP44193.1| hypothetical protein KK1_034357 [Cajanus cajan] Length = 236 Score = 75.9 bits (185), Expect = 2e-13 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 1 PSYLTGEFPGDYGWDTAGLSADPEAFAKNRALEV 102 PSYLTGEFPGDYGWDTAGLSADPEAFAKNRALEV Sbjct: 63 PSYLTGEFPGDYGWDTAGLSADPEAFAKNRALEV 96 >gb|KVI10519.1| Chlorophyll A-B binding protein [Cynara cardunculus var. scolymus] Length = 237 Score = 75.9 bits (185), Expect = 2e-13 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 1 PSYLTGEFPGDYGWDTAGLSADPEAFAKNRALEV 102 PSYLTGEFPGDYGWDTAGLSADPEAFAKNRALEV Sbjct: 36 PSYLTGEFPGDYGWDTAGLSADPEAFAKNRALEV 69 >ref|XP_013464782.1| light-harvesting complex I chlorophyll A/B-binding protein [Medicago truncatula] gb|KEH38817.1| light-harvesting complex I chlorophyll A/B-binding protein [Medicago truncatula] Length = 237 Score = 75.9 bits (185), Expect = 2e-13 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 1 PSYLTGEFPGDYGWDTAGLSADPEAFAKNRALEV 102 PSYLTGEFPGDYGWDTAGLSADPEAFAKNRALEV Sbjct: 36 PSYLTGEFPGDYGWDTAGLSADPEAFAKNRALEV 69 >gb|PNT59393.1| hypothetical protein POPTR_001G407100v3 [Populus trichocarpa] Length = 240 Score = 75.9 bits (185), Expect = 2e-13 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 1 PSYLTGEFPGDYGWDTAGLSADPEAFAKNRALEV 102 PSYLTGEFPGDYGWDTAGLSADPEAFAKNRALEV Sbjct: 39 PSYLTGEFPGDYGWDTAGLSADPEAFAKNRALEV 72 >pdb|5XNL|3 Chain 3, Structure Of Stacked C2s2m2-type Psii-lhcii Supercomplex From Pisum Sativum pdb|5XNL|7 Chain 7, Structure Of Stacked C2s2m2-type Psii-lhcii Supercomplex From Pisum Sativum pdb|5XNM|3 Chain 3, Structure Of Unstacked C2s2m2-type Psii-lhcii Supercomplex From Pisum Sativum pdb|5XNM|7 Chain 7, Structure Of Unstacked C2s2m2-type Psii-lhcii Supercomplex From Pisum Sativum pdb|5XNN|3 Chain 3, Structure Of M-lhcii And Cp24 Complexes In The Stacked C2s2m2-type Psii-lhcii Supercomplex From Pisum Sativum pdb|5XNO|3 Chain 3, Structure Of M-lhcii And Cp24 Complexes In The Unstacked C2s2m2-type Psii-lhcii Supercomplex From Pisum Sativum Length = 243 Score = 75.9 bits (185), Expect = 2e-13 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 1 PSYLTGEFPGDYGWDTAGLSADPEAFAKNRALEV 102 PSYLTGEFPGDYGWDTAGLSADPEAFAKNRALEV Sbjct: 42 PSYLTGEFPGDYGWDTAGLSADPEAFAKNRALEV 75 >gb|PIA54983.1| hypothetical protein AQUCO_00800013v1 [Aquilegia coerulea] Length = 249 Score = 75.9 bits (185), Expect = 2e-13 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 1 PSYLTGEFPGDYGWDTAGLSADPEAFAKNRALEV 102 PSYLTGEFPGDYGWDTAGLSADPEAFAKNRALEV Sbjct: 48 PSYLTGEFPGDYGWDTAGLSADPEAFAKNRALEV 81