BLASTX nr result
ID: Chrysanthemum22_contig00022766
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00022766 (668 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|OTG38162.1| putative F-box/RNI-like/FBD-like domains-containi... 77 8e-15 ref|XP_021984933.1| F-box protein At4g22280-like [Helianthus ann... 78 3e-14 ref|XP_022031683.1| FBD-associated F-box protein At2g26860-like ... 57 4e-09 ref|XP_022031685.1| FBD-associated F-box protein At2g26860-like ... 54 5e-08 >gb|OTG38162.1| putative F-box/RNI-like/FBD-like domains-containing protein [Helianthus annuus] Length = 450 Score = 76.6 bits (187), Expect(2) = 8e-15 Identities = 40/74 (54%), Positives = 51/74 (68%) Frame = -1 Query: 569 PVLPPDCLPFKMKEITILNYDTITEGELSYIEHFLKHLINLEKLRINAYNIRCKRAKEIL 390 PV P CL FKMK+I I+N +TIT EL I++ LK +LE L INA+ I KR +++L Sbjct: 377 PVEVPPCLRFKMKKIIIVNRETITPEELKLIKYLLKRANHLEILTINAHKIDPKRREQVL 436 Query: 389 TFYRASNLCRIEFM 348 FYRAS CRIEF+ Sbjct: 437 KFYRASKSCRIEFV 450 Score = 32.0 bits (71), Expect(2) = 8e-15 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -2 Query: 667 WDFLLKLLSNMPNLEHITFLD 605 W L MPNLEHITFLD Sbjct: 338 WSMLPTFFDKMPNLEHITFLD 358 >ref|XP_021984933.1| F-box protein At4g22280-like [Helianthus annuus] gb|OTG38158.1| putative F-box/RNI-like superfamily protein [Helianthus annuus] Length = 452 Score = 77.8 bits (190), Expect(2) = 3e-14 Identities = 42/88 (47%), Positives = 53/88 (60%) Frame = -1 Query: 611 FGYCKGYYWHRTAEPVLPPDCLPFKMKEITILNYDTITEGELSYIEHFLKHLINLEKLRI 432 F + + Y R PV P CL FKMK+ITI N +T+T EL I + LKH +LE L I Sbjct: 365 FPHAQHIYTMRWNPPVEVPTCLRFKMKKITIKNRETVTPEELKLISYMLKHANHLEILTI 424 Query: 431 NAYNIRCKRAKEILTFYRASNLCRIEFM 348 NA+ I K ++L FYR S CRIEF+ Sbjct: 425 NAHKIDPKTRGQVLKFYRGSKSCRIEFV 452 Score = 28.9 bits (63), Expect(2) = 3e-14 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = -2 Query: 667 WDFLLKLLSNMPNLEHITFL 608 W L + MPN+EHITFL Sbjct: 340 WSMLPTFFNKMPNVEHITFL 359 >ref|XP_022031683.1| FBD-associated F-box protein At2g26860-like [Helianthus annuus] Length = 471 Score = 57.0 bits (136), Expect(2) = 4e-09 Identities = 32/74 (43%), Positives = 44/74 (59%) Frame = -1 Query: 611 FGYCKGYYWHRTAEPVLPPDCLPFKMKEITILNYDTITEGELSYIEHFLKHLINLEKLRI 432 F + + + R PV P CL FKMK+I I+N +TIT EL I + LKH +LE L + Sbjct: 343 FPHAQHTFTMRWNPPVEVPPCLRFKMKKIIIVNRETITPKELKLIRYLLKHANHLEILTM 402 Query: 431 NAYNIRCKRAKEIL 390 NA+ I KR ++ L Sbjct: 403 NAHKIDPKRREQCL 416 Score = 32.3 bits (72), Expect(2) = 4e-09 Identities = 13/21 (61%), Positives = 14/21 (66%) Frame = -2 Query: 667 WDFLLKLLSNMPNLEHITFLD 605 W L + MPNLEHITFLD Sbjct: 318 WSMLPTFFNKMPNLEHITFLD 338 >ref|XP_022031685.1| FBD-associated F-box protein At2g26860-like [Helianthus annuus] Length = 462 Score = 53.5 bits (127), Expect(2) = 5e-08 Identities = 29/58 (50%), Positives = 38/58 (65%) Frame = -1 Query: 569 PVLPPDCLPFKMKEITILNYDTITEGELSYIEHFLKHLINLEKLRINAYNIRCKRAKE 396 PV P CL FKMK+I I+N +TIT EL I++ LK +LE L INA+ I KR ++ Sbjct: 377 PVEVPPCLRFKMKKIIIVNRETITPEELKLIKYLLKRANHLEILTINAHKIDPKRREQ 434 Score = 32.0 bits (71), Expect(2) = 5e-08 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -2 Query: 667 WDFLLKLLSNMPNLEHITFLD 605 W L MPNLEHITFLD Sbjct: 338 WSMLPTFFDKMPNLEHITFLD 358