BLASTX nr result
ID: Chrysanthemum22_contig00022699
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00022699 (524 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVH88159.1| hypothetical protein Ccrd_024450 [Cynara carduncu... 65 9e-11 ref|XP_021988827.1| uncharacterized protein LOC110885447 isoform... 60 3e-07 ref|XP_021988826.1| uncharacterized protein LOC110885447 isoform... 60 3e-07 ref|XP_023730183.1| uncharacterized protein LOC111877911 [Lactuc... 59 9e-07 >gb|KVH88159.1| hypothetical protein Ccrd_024450 [Cynara cardunculus var. scolymus] Length = 1890 Score = 64.7 bits (156), Expect(2) = 9e-11 Identities = 32/42 (76%), Positives = 37/42 (88%) Frame = +3 Query: 114 QIADFRNSIIMIISDKSPSDEYLVVNTFKMLASAAYYQVCIF 239 QIADFRNSIIMIIS++SPS+E L+V+ FKMLASAAYYQ F Sbjct: 864 QIADFRNSIIMIISEQSPSNEDLIVSMFKMLASAAYYQPAFF 905 Score = 29.3 bits (64), Expect(2) = 9e-11 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +1 Query: 1 SGNACFGLDDKQV 39 SGNAC GLDDKQ+ Sbjct: 853 SGNACLGLDDKQI 865 >ref|XP_021988827.1| uncharacterized protein LOC110885447 isoform X2 [Helianthus annuus] gb|OTG11464.1| Protein of unknown function (DUF3414) [Helianthus annuus] Length = 1873 Score = 60.1 bits (144), Expect = 3e-07 Identities = 33/47 (70%), Positives = 37/47 (78%), Gaps = 5/47 (10%) Frame = +3 Query: 102 HACY-----QIADFRNSIIMIISDKSPSDEYLVVNTFKMLASAAYYQ 227 +AC+ QIADFRNS I IISD+S S E L+VNTFKMLASAAYYQ Sbjct: 900 NACFGLDDKQIADFRNSSITIISDRSFSHEDLIVNTFKMLASAAYYQ 946 >ref|XP_021988826.1| uncharacterized protein LOC110885447 isoform X1 [Helianthus annuus] Length = 1874 Score = 60.1 bits (144), Expect = 3e-07 Identities = 33/47 (70%), Positives = 37/47 (78%), Gaps = 5/47 (10%) Frame = +3 Query: 102 HACY-----QIADFRNSIIMIISDKSPSDEYLVVNTFKMLASAAYYQ 227 +AC+ QIADFRNS I IISD+S S E L+VNTFKMLASAAYYQ Sbjct: 901 NACFGLDDKQIADFRNSSITIISDRSFSHEDLIVNTFKMLASAAYYQ 947 >ref|XP_023730183.1| uncharacterized protein LOC111877911 [Lactuca sativa] gb|PLY76643.1| hypothetical protein LSAT_4X74700 [Lactuca sativa] Length = 1850 Score = 58.5 bits (140), Expect = 9e-07 Identities = 30/47 (63%), Positives = 37/47 (78%), Gaps = 5/47 (10%) Frame = +3 Query: 102 HACY-----QIADFRNSIIMIISDKSPSDEYLVVNTFKMLASAAYYQ 227 +AC+ QIADFR SI +IIS++SP +E L+ NTFKMLASAAYYQ Sbjct: 904 NACFGLDDKQIADFRKSIALIISEQSPLNEDLIANTFKMLASAAYYQ 950