BLASTX nr result
ID: Chrysanthemum22_contig00022570
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00022570 (405 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|OTF98967.1| hypothetical protein HannXRQ_Chr14g0451431 [Helia... 63 1e-08 gb|KVI09278.1| hypothetical protein Ccrd_012418 [Cynara carduncu... 62 2e-08 ref|XP_022005682.1| uncharacterized membrane protein At3g27390-l... 60 6e-08 ref|XP_022005683.1| uncharacterized membrane protein At3g27390-l... 60 1e-07 ref|XP_022005678.1| uncharacterized membrane protein At3g27390-l... 58 4e-07 ref|XP_023741313.1| uncharacterized membrane protein At3g27390-l... 58 5e-07 >gb|OTF98967.1| hypothetical protein HannXRQ_Chr14g0451431 [Helianthus annuus] Length = 1707 Score = 62.8 bits (151), Expect = 1e-08 Identities = 28/40 (70%), Positives = 33/40 (82%) Frame = -2 Query: 218 LIYYSYLTDVCLYSYFSMLDDLRKQDPPGGRIEIKLDTIF 99 L + L DVCLYSYFSM DDLRKQDPPGGRIEI++D ++ Sbjct: 143 LTFVRDLMDVCLYSYFSMTDDLRKQDPPGGRIEIRVDGVW 182 Score = 59.7 bits (143), Expect = 1e-07 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = -2 Query: 218 LIYYSYLTDVCLYSYFSMLDDLRKQDPPGGRIEIKL 111 L + L DVCLYSYFSM DDLRKQDPPGGRIEI++ Sbjct: 189 LTFVRDLMDVCLYSYFSMTDDLRKQDPPGGRIEIRV 224 >gb|KVI09278.1| hypothetical protein Ccrd_012418 [Cynara cardunculus var. scolymus] Length = 516 Score = 61.6 bits (148), Expect = 2e-08 Identities = 30/52 (57%), Positives = 37/52 (71%) Frame = -2 Query: 266 FSKKLYNDNYNLI*QDLIYYSYLTDVCLYSYFSMLDDLRKQDPPGGRIEIKL 111 F L + ++ I L + L DVCLYSYF+M+DDLRKQDPPGGRIEI+L Sbjct: 127 FRHCLIDGIWDTIKWSLTFVRDLNDVCLYSYFAMMDDLRKQDPPGGRIEIRL 178 >ref|XP_022005682.1| uncharacterized membrane protein At3g27390-like [Helianthus annuus] Length = 254 Score = 59.7 bits (143), Expect = 6e-08 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = -2 Query: 218 LIYYSYLTDVCLYSYFSMLDDLRKQDPPGGRIEIKL 111 L + L DVCLYSYFSM DDLRKQDPPGGRIEI++ Sbjct: 22 LTFVRDLMDVCLYSYFSMTDDLRKQDPPGGRIEIRV 57 >ref|XP_022005683.1| uncharacterized membrane protein At3g27390-like [Helianthus annuus] Length = 579 Score = 59.7 bits (143), Expect = 1e-07 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = -2 Query: 218 LIYYSYLTDVCLYSYFSMLDDLRKQDPPGGRIEIKL 111 L + L DVCLYSYFSM DDLRKQDPPGGRIEI++ Sbjct: 143 LTFVRDLMDVCLYSYFSMTDDLRKQDPPGGRIEIRV 178 >ref|XP_022005678.1| uncharacterized membrane protein At3g27390-like [Helianthus annuus] ref|XP_022005679.1| uncharacterized membrane protein At3g27390-like [Helianthus annuus] ref|XP_022005680.1| uncharacterized membrane protein At3g27390-like [Helianthus annuus] Length = 432 Score = 58.2 bits (139), Expect = 4e-07 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = -2 Query: 194 DVCLYSYFSMLDDLRKQDPPGGRIEIKL 111 DVCLYSYFSM DDLRKQDPPGGRIEI++ Sbjct: 2 DVCLYSYFSMTDDLRKQDPPGGRIEIRV 29 >ref|XP_023741313.1| uncharacterized membrane protein At3g27390-like [Lactuca sativa] gb|PLY96802.1| hypothetical protein LSAT_2X93480 [Lactuca sativa] Length = 581 Score = 57.8 bits (138), Expect = 5e-07 Identities = 27/52 (51%), Positives = 37/52 (71%) Frame = -2 Query: 266 FSKKLYNDNYNLI*QDLIYYSYLTDVCLYSYFSMLDDLRKQDPPGGRIEIKL 111 F + + ++ I L + L+DVCLYSYFS++DDLRKQDPP GRIEI++ Sbjct: 127 FRHCVIDGTWDTIKWSLTFVRDLSDVCLYSYFSVMDDLRKQDPPDGRIEIRV 178