BLASTX nr result
ID: Chrysanthemum22_contig00022284
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00022284 (385 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVI02136.1| Zinc finger, B-box [Cynara cardunculus var. scoly... 59 1e-07 >gb|KVI02136.1| Zinc finger, B-box [Cynara cardunculus var. scolymus] Length = 301 Score = 58.9 bits (141), Expect = 1e-07 Identities = 31/49 (63%), Positives = 33/49 (67%), Gaps = 2/49 (4%) Frame = -3 Query: 383 SGLCWPKXXXXXXXHQIDTPAFVPDVSYSPMPNSYNSQQQ--TLKRRRH 243 SGLCWPK QID+ AFVPDV Y P+PN Y SQQ TLKRRRH Sbjct: 253 SGLCWPKDLPHHQH-QIDSAAFVPDVCYLPVPNFYGSQQNTGTLKRRRH 300