BLASTX nr result
ID: Chrysanthemum22_contig00022215
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00022215 (423 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVH93787.1| DnaJ domain-containing protein [Cynara cardunculu... 55 5e-06 >gb|KVH93787.1| DnaJ domain-containing protein [Cynara cardunculus var. scolymus] Length = 357 Score = 55.1 bits (131), Expect = 5e-06 Identities = 24/32 (75%), Positives = 27/32 (84%) Frame = -2 Query: 422 THNCRLEMQRLQWGYYQPTTPNCDRLKQFEAL 327 +HNCRLEMQR+ WG YQ TPNCD LKQF+AL Sbjct: 326 SHNCRLEMQRIHWG-YQQETPNCDMLKQFKAL 356