BLASTX nr result
ID: Chrysanthemum22_contig00022027
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00022027 (440 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDO82796.1| hypothetical protein CISIN_1g0238542mg, partial [... 87 1e-19 gb|KVH97773.1| hypothetical protein Ccrd_000128 [Cynara carduncu... 91 3e-19 gb|ABI73982.1| voltage-dependent anion-selective channel protein... 85 8e-19 gb|KVH96127.1| Eukaryotic porin/Tom40 [Cynara cardunculus var. s... 89 1e-18 ref|XP_023911743.1| mitochondrial outer membrane protein porin o... 89 2e-18 ref|XP_018835940.1| PREDICTED: mitochondrial outer membrane prot... 89 2e-18 gb|POO00019.1| Porin type [Trema orientalis] 89 2e-18 gb|PON67500.1| Porin type [Parasponia andersonii] 89 2e-18 ref|XP_022776944.1| mitochondrial outer membrane protein porin o... 88 2e-18 gb|OWM74673.1| hypothetical protein CDL15_Pgr016284 [Punica gran... 87 4e-18 ref|XP_011463658.1| PREDICTED: mitochondrial outer membrane prot... 84 4e-18 ref|XP_022776943.1| mitochondrial outer membrane protein porin o... 88 4e-18 ref|XP_024195102.1| mitochondrial outer membrane protein porin o... 87 6e-18 ref|XP_023928050.1| mitochondrial outer membrane protein porin o... 87 6e-18 ref|XP_023743179.1| mitochondrial outer membrane protein porin o... 87 6e-18 dbj|GAY36571.1| hypothetical protein CUMW_023030 [Citrus unshiu] 87 6e-18 ref|XP_022151340.1| mitochondrial outer membrane protein porin o... 87 6e-18 ref|XP_021655333.1| mitochondrial outer membrane protein porin o... 87 6e-18 ref|XP_021685418.1| mitochondrial outer membrane protein porin o... 87 6e-18 gb|OWM75978.1| hypothetical protein CDL15_Pgr009623 [Punica gran... 87 6e-18 >gb|KDO82796.1| hypothetical protein CISIN_1g0238542mg, partial [Citrus sinensis] gb|KDO82797.1| hypothetical protein CISIN_1g0238542mg, partial [Citrus sinensis] Length = 101 Score = 87.4 bits (215), Expect = 1e-19 Identities = 42/47 (89%), Positives = 45/47 (95%) Frame = -1 Query: 440 RVNNFGIASALLQHEWRPKSLFTISAEVDTRAIEKSAKVGLALALKP 300 RVNN+G ASAL+QHEWRPKSLFTIS EVDTRAIEKSAK+GLALALKP Sbjct: 55 RVNNYGRASALIQHEWRPKSLFTISGEVDTRAIEKSAKIGLALALKP 101 >gb|KVH97773.1| hypothetical protein Ccrd_000128 [Cynara cardunculus var. scolymus] Length = 276 Score = 90.9 bits (224), Expect = 3e-19 Identities = 45/47 (95%), Positives = 45/47 (95%) Frame = -1 Query: 440 RVNNFGIASALLQHEWRPKSLFTISAEVDTRAIEKSAKVGLALALKP 300 RVNNFGIASALLQHEWRPKS FTIS EVDTRAIEKSAKVGLALALKP Sbjct: 230 RVNNFGIASALLQHEWRPKSFFTISGEVDTRAIEKSAKVGLALALKP 276 >gb|ABI73982.1| voltage-dependent anion-selective channel protein, partial [Musa acuminata AAA Group] Length = 81 Score = 84.7 bits (208), Expect = 8e-19 Identities = 39/47 (82%), Positives = 45/47 (95%) Frame = -1 Query: 440 RVNNFGIASALLQHEWRPKSLFTISAEVDTRAIEKSAKVGLALALKP 300 RVNNFG+A+AL+QHEWRPKSLFTIS EVDT+A++KSAK GLALALKP Sbjct: 35 RVNNFGMATALIQHEWRPKSLFTISGEVDTKAVDKSAKFGLALALKP 81 >gb|KVH96127.1| Eukaryotic porin/Tom40 [Cynara cardunculus var. scolymus] Length = 276 Score = 89.4 bits (220), Expect = 1e-18 Identities = 45/47 (95%), Positives = 45/47 (95%) Frame = -1 Query: 440 RVNNFGIASALLQHEWRPKSLFTISAEVDTRAIEKSAKVGLALALKP 300 RVNN GIASALLQHEWRPKSLFTIS EVDTRAIEKSAKVGLALALKP Sbjct: 230 RVNNSGIASALLQHEWRPKSLFTISGEVDTRAIEKSAKVGLALALKP 276 >ref|XP_023911743.1| mitochondrial outer membrane protein porin of 34 kDa [Quercus suber] gb|POF11200.1| mitochondrial outer membrane protein porin of 34 kda [Quercus suber] Length = 276 Score = 89.0 bits (219), Expect = 2e-18 Identities = 44/47 (93%), Positives = 45/47 (95%) Frame = -1 Query: 440 RVNNFGIASALLQHEWRPKSLFTISAEVDTRAIEKSAKVGLALALKP 300 RVNNFG ASAL+QHEWRPKSLFTIS EVDTRAIEKSAKVGLALALKP Sbjct: 230 RVNNFGKASALIQHEWRPKSLFTISGEVDTRAIEKSAKVGLALALKP 276 >ref|XP_018835940.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like [Juglans regia] Length = 276 Score = 89.0 bits (219), Expect = 2e-18 Identities = 44/47 (93%), Positives = 45/47 (95%) Frame = -1 Query: 440 RVNNFGIASALLQHEWRPKSLFTISAEVDTRAIEKSAKVGLALALKP 300 RVNNFG ASAL+QHEWRPKSLFTIS EVDTRAIEKSAKVGLALALKP Sbjct: 230 RVNNFGKASALIQHEWRPKSLFTISGEVDTRAIEKSAKVGLALALKP 276 >gb|POO00019.1| Porin type [Trema orientalis] Length = 276 Score = 88.6 bits (218), Expect = 2e-18 Identities = 43/47 (91%), Positives = 45/47 (95%) Frame = -1 Query: 440 RVNNFGIASALLQHEWRPKSLFTISAEVDTRAIEKSAKVGLALALKP 300 RVNNFG ASAL+QHEWRPKSLFTIS EVDTRAIEKSAK+GLALALKP Sbjct: 230 RVNNFGRASALIQHEWRPKSLFTISGEVDTRAIEKSAKIGLALALKP 276 >gb|PON67500.1| Porin type [Parasponia andersonii] Length = 276 Score = 88.6 bits (218), Expect = 2e-18 Identities = 43/47 (91%), Positives = 45/47 (95%) Frame = -1 Query: 440 RVNNFGIASALLQHEWRPKSLFTISAEVDTRAIEKSAKVGLALALKP 300 RVNNFG ASAL+QHEWRPKSLFTIS EVDTRAIEKSAK+GLALALKP Sbjct: 230 RVNNFGRASALIQHEWRPKSLFTISGEVDTRAIEKSAKIGLALALKP 276 >ref|XP_022776944.1| mitochondrial outer membrane protein porin of 36 kDa-like isoform X2 [Durio zibethinus] Length = 239 Score = 87.8 bits (216), Expect = 2e-18 Identities = 43/47 (91%), Positives = 45/47 (95%) Frame = -1 Query: 440 RVNNFGIASALLQHEWRPKSLFTISAEVDTRAIEKSAKVGLALALKP 300 RVNN+G ASAL+QHEWRPKSLFTIS EVDTRAIEKSAKVGLALALKP Sbjct: 193 RVNNYGKASALIQHEWRPKSLFTISGEVDTRAIEKSAKVGLALALKP 239 >gb|OWM74673.1| hypothetical protein CDL15_Pgr016284 [Punica granatum] Length = 244 Score = 87.4 bits (215), Expect = 4e-18 Identities = 42/47 (89%), Positives = 45/47 (95%) Frame = -1 Query: 440 RVNNFGIASALLQHEWRPKSLFTISAEVDTRAIEKSAKVGLALALKP 300 RVNN+G ASAL+QHEWRPKSLFTIS EVDTRAIEKSAK+GLALALKP Sbjct: 198 RVNNYGRASALIQHEWRPKSLFTISGEVDTRAIEKSAKIGLALALKP 244 >ref|XP_011463658.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like [Fragaria vesca subsp. vesca] Length = 110 Score = 84.0 bits (206), Expect = 4e-18 Identities = 40/47 (85%), Positives = 43/47 (91%) Frame = -1 Query: 440 RVNNFGIASALLQHEWRPKSLFTISAEVDTRAIEKSAKVGLALALKP 300 RVNNFG A+AL+QHEWRPKS FTIS EVDTRAIEKSAK+GL LALKP Sbjct: 64 RVNNFGKANALIQHEWRPKSFFTISREVDTRAIEKSAKIGLVLALKP 110 >ref|XP_022776943.1| mitochondrial outer membrane protein porin of 36 kDa-like isoform X1 [Durio zibethinus] Length = 276 Score = 87.8 bits (216), Expect = 4e-18 Identities = 43/47 (91%), Positives = 45/47 (95%) Frame = -1 Query: 440 RVNNFGIASALLQHEWRPKSLFTISAEVDTRAIEKSAKVGLALALKP 300 RVNN+G ASAL+QHEWRPKSLFTIS EVDTRAIEKSAKVGLALALKP Sbjct: 230 RVNNYGKASALIQHEWRPKSLFTISGEVDTRAIEKSAKVGLALALKP 276 >ref|XP_024195102.1| mitochondrial outer membrane protein porin of 36 kDa [Rosa chinensis] gb|PRQ40852.1| putative Porin domain-containing protein [Rosa chinensis] Length = 276 Score = 87.4 bits (215), Expect = 6e-18 Identities = 42/47 (89%), Positives = 45/47 (95%) Frame = -1 Query: 440 RVNNFGIASALLQHEWRPKSLFTISAEVDTRAIEKSAKVGLALALKP 300 RVNN+G ASAL+QHEWRPKSLFTIS EVDTRAIEKSAK+GLALALKP Sbjct: 230 RVNNYGRASALIQHEWRPKSLFTISGEVDTRAIEKSAKIGLALALKP 276 >ref|XP_023928050.1| mitochondrial outer membrane protein porin of 36 kDa [Quercus suber] gb|POE91278.1| mitochondrial outer membrane protein porin of 36 kda [Quercus suber] Length = 276 Score = 87.4 bits (215), Expect = 6e-18 Identities = 42/47 (89%), Positives = 45/47 (95%) Frame = -1 Query: 440 RVNNFGIASALLQHEWRPKSLFTISAEVDTRAIEKSAKVGLALALKP 300 RVNN+G ASAL+QHEWRPKSLFTIS EVDTRAIEKSAK+GLALALKP Sbjct: 230 RVNNYGRASALIQHEWRPKSLFTISGEVDTRAIEKSAKIGLALALKP 276 >ref|XP_023743179.1| mitochondrial outer membrane protein porin of 36 kDa-like [Lactuca sativa] gb|PLY66622.1| hypothetical protein LSAT_3X51460 [Lactuca sativa] Length = 276 Score = 87.4 bits (215), Expect = 6e-18 Identities = 43/47 (91%), Positives = 45/47 (95%) Frame = -1 Query: 440 RVNNFGIASALLQHEWRPKSLFTISAEVDTRAIEKSAKVGLALALKP 300 RVNN GIASA+LQHEWRPKSLFTIS EVDTRAIEKSAKVGLA+ALKP Sbjct: 230 RVNNAGIASAVLQHEWRPKSLFTISGEVDTRAIEKSAKVGLAIALKP 276 >dbj|GAY36571.1| hypothetical protein CUMW_023030 [Citrus unshiu] Length = 276 Score = 87.4 bits (215), Expect = 6e-18 Identities = 42/47 (89%), Positives = 45/47 (95%) Frame = -1 Query: 440 RVNNFGIASALLQHEWRPKSLFTISAEVDTRAIEKSAKVGLALALKP 300 RVNN+G ASAL+QHEWRPKSLFTIS EVDTRAIEKSAK+GLALALKP Sbjct: 230 RVNNYGRASALIQHEWRPKSLFTISGEVDTRAIEKSAKIGLALALKP 276 >ref|XP_022151340.1| mitochondrial outer membrane protein porin of 36 kDa [Momordica charantia] Length = 276 Score = 87.4 bits (215), Expect = 6e-18 Identities = 42/47 (89%), Positives = 45/47 (95%) Frame = -1 Query: 440 RVNNFGIASALLQHEWRPKSLFTISAEVDTRAIEKSAKVGLALALKP 300 RVNN+G ASAL+QHEWRPKSLFTIS EVDTRAIEKSAK+GLALALKP Sbjct: 230 RVNNYGRASALIQHEWRPKSLFTISGEVDTRAIEKSAKIGLALALKP 276 >ref|XP_021655333.1| mitochondrial outer membrane protein porin of 36 kDa-like [Hevea brasiliensis] Length = 276 Score = 87.4 bits (215), Expect = 6e-18 Identities = 42/47 (89%), Positives = 45/47 (95%) Frame = -1 Query: 440 RVNNFGIASALLQHEWRPKSLFTISAEVDTRAIEKSAKVGLALALKP 300 RVNN+G ASAL+QHEWRPKSLFTIS EVDTRAIEKSAK+GLALALKP Sbjct: 230 RVNNYGRASALIQHEWRPKSLFTISGEVDTRAIEKSAKIGLALALKP 276 >ref|XP_021685418.1| mitochondrial outer membrane protein porin of 36 kDa [Hevea brasiliensis] Length = 276 Score = 87.4 bits (215), Expect = 6e-18 Identities = 42/47 (89%), Positives = 45/47 (95%) Frame = -1 Query: 440 RVNNFGIASALLQHEWRPKSLFTISAEVDTRAIEKSAKVGLALALKP 300 RVNN+G ASAL+QHEWRPKSLFTIS EVDTRAIEKSAK+GLALALKP Sbjct: 230 RVNNYGRASALIQHEWRPKSLFTISGEVDTRAIEKSAKIGLALALKP 276 >gb|OWM75978.1| hypothetical protein CDL15_Pgr009623 [Punica granatum] gb|PKI36873.1| hypothetical protein CRG98_042822 [Punica granatum] Length = 276 Score = 87.4 bits (215), Expect = 6e-18 Identities = 42/47 (89%), Positives = 45/47 (95%) Frame = -1 Query: 440 RVNNFGIASALLQHEWRPKSLFTISAEVDTRAIEKSAKVGLALALKP 300 RVNN+G ASAL+QHEWRPKSLFTIS EVDTRAIEKSAK+GLALALKP Sbjct: 230 RVNNYGRASALIQHEWRPKSLFTISGEVDTRAIEKSAKIGLALALKP 276