BLASTX nr result
ID: Chrysanthemum22_contig00021751
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00021751 (1856 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACU23892.1| unknown [Glycine max] 55 3e-06 gb|POE89205.1| protein dehydration-induced 19 like 4 [Quercus su... 57 3e-06 gb|KJB34867.1| hypothetical protein B456_006G088100 [Gossypium r... 57 7e-06 emb|CBI30603.3| unnamed protein product, partial [Vitis vinifera] 56 8e-06 ref|XP_009343251.1| PREDICTED: protein DEHYDRATION-INDUCED 19-li... 58 1e-05 ref|XP_008371405.1| PREDICTED: protein DEHYDRATION-INDUCED 19-li... 58 1e-05 >gb|ACU23892.1| unknown [Glycine max] Length = 65 Score = 55.5 bits (132), Expect = 3e-06 Identities = 28/48 (58%), Positives = 33/48 (68%) Frame = -1 Query: 1856 EDFDIASLCSHLEDEHSCESRATVIQLYLSFYVFLTFQKGLTFLDICF 1713 EDFDIASLCSHLEDEHSCESR TV +F++F L++CF Sbjct: 16 EDFDIASLCSHLEDEHSCESRVTVGACSFLSLIFISFP--CCNLNLCF 61 >gb|POE89205.1| protein dehydration-induced 19 like 4 [Quercus suber] Length = 104 Score = 56.6 bits (135), Expect = 3e-06 Identities = 23/31 (74%), Positives = 28/31 (90%) Frame = -3 Query: 93 EFSLQICPVCSVKVSREMLSHITLQHGHLFK 1 E + +CP+CSVKV+R+MLSHITLQHGHLFK Sbjct: 71 ESKVTVCPICSVKVARDMLSHITLQHGHLFK 101 >gb|KJB34867.1| hypothetical protein B456_006G088100 [Gossypium raimondii] Length = 172 Score = 57.4 bits (137), Expect = 7e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -3 Query: 90 FSLQICPVCSVKVSREMLSHITLQHGHLFK 1 F LQICPVC VKVSR+MLSHITLQHG+LFK Sbjct: 11 FLLQICPVCYVKVSRDMLSHITLQHGNLFK 40 >emb|CBI30603.3| unnamed protein product, partial [Vitis vinifera] Length = 135 Score = 56.2 bits (134), Expect = 8e-06 Identities = 23/31 (74%), Positives = 28/31 (90%) Frame = -3 Query: 93 EFSLQICPVCSVKVSREMLSHITLQHGHLFK 1 E + +CP+CSVKV+R+MLSHITLQHGHLFK Sbjct: 71 ESRVTVCPICSVKVARDMLSHITLQHGHLFK 101 >ref|XP_009343251.1| PREDICTED: protein DEHYDRATION-INDUCED 19-like [Pyrus x bretschneideri] Length = 232 Score = 58.2 bits (139), Expect = 1e-05 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -3 Query: 93 EFSLQICPVCSVKVSREMLSHITLQHGHLFK 1 E + ICP+CSVKVSR+MLSHITLQHGHLFK Sbjct: 71 ESKVTICPICSVKVSRDMLSHITLQHGHLFK 101 >ref|XP_008371405.1| PREDICTED: protein DEHYDRATION-INDUCED 19-like [Malus domestica] Length = 232 Score = 58.2 bits (139), Expect = 1e-05 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -3 Query: 93 EFSLQICPVCSVKVSREMLSHITLQHGHLFK 1 E + ICP+CSVKVSR+MLSHITLQHGHLFK Sbjct: 71 ESKVTICPICSVKVSRDMLSHITLQHGHLFK 101