BLASTX nr result
ID: Chrysanthemum22_contig00021660
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00021660 (943 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PPR91381.1| hypothetical protein GOBAR_AA29299 [Gossypium bar... 69 3e-09 gb|EEF50154.1| respiratory burst oxidase, putative [Ricinus comm... 69 5e-09 gb|AND76216.1| respiratory burst oxidase-like protein, partial [... 69 5e-09 gb|KVH98073.1| Calcium-binding EF-hand [Cynara cardunculus var. ... 69 5e-09 gb|PNT45874.1| hypothetical protein POPTR_003G159800v3 [Populus ... 69 5e-09 ref|XP_012090542.1| respiratory burst oxidase homolog protein C ... 69 5e-09 gb|PLY66797.1| hypothetical protein LSAT_5X9460 [Lactuca sativa] 69 5e-09 ref|XP_021624267.1| respiratory burst oxidase homolog protein D-... 69 5e-09 ref|XP_015570593.1| PREDICTED: respiratory burst oxidase homolog... 69 5e-09 ref|XP_022011401.1| respiratory burst oxidase homolog protein C-... 69 5e-09 dbj|GAV89886.1| Ferric_reduct domain-containing protein/FAD_bind... 69 5e-09 ref|XP_023742957.1| respiratory burst oxidase homolog protein C-... 69 5e-09 ref|XP_010250429.1| PREDICTED: respiratory burst oxidase homolog... 69 5e-09 ref|XP_011020924.1| PREDICTED: respiratory burst oxidase homolog... 69 5e-09 ref|XP_002303736.2| hypothetical protein POPTR_0003s15810g [Popu... 69 5e-09 ref|XP_009353482.1| PREDICTED: respiratory burst oxidase homolog... 69 5e-09 ref|XP_008378424.1| PREDICTED: respiratory burst oxidase homolog... 69 5e-09 ref|XP_021827478.1| respiratory burst oxidase homolog protein D-... 69 5e-09 ref|XP_008222292.1| PREDICTED: respiratory burst oxidase homolog... 69 5e-09 ref|XP_007225362.1| respiratory burst oxidase homolog protein D ... 69 5e-09 >gb|PPR91381.1| hypothetical protein GOBAR_AA29299 [Gossypium barbadense] Length = 942 Score = 69.3 bits (168), Expect = 3e-09 Identities = 30/38 (78%), Positives = 32/38 (84%) Frame = -1 Query: 460 SKPAGFKYKSGQYMFVNFFAASPFEWHPISINSALGDD 347 SKP GFKYKSGQYMFVN+ A SPFEWHP SI S+ GDD Sbjct: 626 SKPQGFKYKSGQYMFVNYSAVSPFEWHPFSITSSPGDD 663 >gb|EEF50154.1| respiratory burst oxidase, putative [Ricinus communis] Length = 709 Score = 68.6 bits (166), Expect = 5e-09 Identities = 31/38 (81%), Positives = 31/38 (81%) Frame = -1 Query: 460 SKPAGFKYKSGQYMFVNFFAASPFEWHPISINSALGDD 347 SKP GFKYKSGQYMFVN A SPFEWHP SI SA GDD Sbjct: 629 SKPQGFKYKSGQYMFVNCAAVSPFEWHPFSITSAPGDD 666 >gb|AND76216.1| respiratory burst oxidase-like protein, partial [Calotropis procera] Length = 840 Score = 68.6 bits (166), Expect = 5e-09 Identities = 31/38 (81%), Positives = 31/38 (81%) Frame = -1 Query: 460 SKPAGFKYKSGQYMFVNFFAASPFEWHPISINSALGDD 347 SKP GFKYKSGQYMFVN A SPFEWHP SI SA GDD Sbjct: 629 SKPQGFKYKSGQYMFVNCAAVSPFEWHPFSITSAPGDD 666 >gb|KVH98073.1| Calcium-binding EF-hand [Cynara cardunculus var. scolymus] Length = 867 Score = 68.6 bits (166), Expect = 5e-09 Identities = 31/38 (81%), Positives = 31/38 (81%) Frame = -1 Query: 460 SKPAGFKYKSGQYMFVNFFAASPFEWHPISINSALGDD 347 SKP GFKYKSGQYMFVN A SPFEWHP SI SA GDD Sbjct: 601 SKPQGFKYKSGQYMFVNCAAVSPFEWHPFSITSAPGDD 638 >gb|PNT45874.1| hypothetical protein POPTR_003G159800v3 [Populus trichocarpa] Length = 894 Score = 68.6 bits (166), Expect = 5e-09 Identities = 31/38 (81%), Positives = 31/38 (81%) Frame = -1 Query: 460 SKPAGFKYKSGQYMFVNFFAASPFEWHPISINSALGDD 347 SKP GFKYKSGQYMFVN A SPFEWHP SI SA GDD Sbjct: 625 SKPQGFKYKSGQYMFVNCAAVSPFEWHPFSITSAPGDD 662 >ref|XP_012090542.1| respiratory burst oxidase homolog protein C [Jatropha curcas] gb|KDP22507.1| hypothetical protein JCGZ_26338 [Jatropha curcas] Length = 904 Score = 68.6 bits (166), Expect = 5e-09 Identities = 31/38 (81%), Positives = 31/38 (81%) Frame = -1 Query: 460 SKPAGFKYKSGQYMFVNFFAASPFEWHPISINSALGDD 347 SKP GFKYKSGQYMFVN A SPFEWHP SI SA GDD Sbjct: 605 SKPQGFKYKSGQYMFVNCAAVSPFEWHPFSITSAPGDD 642 >gb|PLY66797.1| hypothetical protein LSAT_5X9460 [Lactuca sativa] Length = 914 Score = 68.6 bits (166), Expect = 5e-09 Identities = 31/38 (81%), Positives = 31/38 (81%) Frame = -1 Query: 460 SKPAGFKYKSGQYMFVNFFAASPFEWHPISINSALGDD 347 SKP GFKYKSGQYMFVN A SPFEWHP SI SA GDD Sbjct: 617 SKPQGFKYKSGQYMFVNCAAVSPFEWHPFSITSAPGDD 654 >ref|XP_021624267.1| respiratory burst oxidase homolog protein D-like [Manihot esculenta] gb|ADR70882.1| respiratory burst oxidase D [Manihot esculenta] gb|OAY42345.1| hypothetical protein MANES_09G172500 [Manihot esculenta] Length = 914 Score = 68.6 bits (166), Expect = 5e-09 Identities = 31/38 (81%), Positives = 31/38 (81%) Frame = -1 Query: 460 SKPAGFKYKSGQYMFVNFFAASPFEWHPISINSALGDD 347 SKP GFKYKSGQYMFVN A SPFEWHP SI SA GDD Sbjct: 617 SKPQGFKYKSGQYMFVNCAAVSPFEWHPFSITSAPGDD 654 >ref|XP_015570593.1| PREDICTED: respiratory burst oxidase homolog protein D [Ricinus communis] Length = 916 Score = 68.6 bits (166), Expect = 5e-09 Identities = 31/38 (81%), Positives = 31/38 (81%) Frame = -1 Query: 460 SKPAGFKYKSGQYMFVNFFAASPFEWHPISINSALGDD 347 SKP GFKYKSGQYMFVN A SPFEWHP SI SA GDD Sbjct: 629 SKPQGFKYKSGQYMFVNCAAVSPFEWHPFSITSAPGDD 666 >ref|XP_022011401.1| respiratory burst oxidase homolog protein C-like [Helianthus annuus] gb|OTG33413.1| putative respiratory burst oxidase [Helianthus annuus] Length = 917 Score = 68.6 bits (166), Expect = 5e-09 Identities = 31/38 (81%), Positives = 31/38 (81%) Frame = -1 Query: 460 SKPAGFKYKSGQYMFVNFFAASPFEWHPISINSALGDD 347 SKP GFKYKSGQYMFVN A SPFEWHP SI SA GDD Sbjct: 623 SKPQGFKYKSGQYMFVNCAAVSPFEWHPFSITSAPGDD 660 >dbj|GAV89886.1| Ferric_reduct domain-containing protein/FAD_binding_8 domain-containing protein/NAD_binding_6 domain-containing protein/NADPH_Ox domain-containing protein [Cephalotus follicularis] Length = 918 Score = 68.6 bits (166), Expect = 5e-09 Identities = 31/38 (81%), Positives = 31/38 (81%) Frame = -1 Query: 460 SKPAGFKYKSGQYMFVNFFAASPFEWHPISINSALGDD 347 SKP GFKYKSGQYMFVN A SPFEWHP SI SA GDD Sbjct: 622 SKPQGFKYKSGQYMFVNCAAVSPFEWHPFSITSAPGDD 659 >ref|XP_023742957.1| respiratory burst oxidase homolog protein C-like [Lactuca sativa] Length = 919 Score = 68.6 bits (166), Expect = 5e-09 Identities = 31/38 (81%), Positives = 31/38 (81%) Frame = -1 Query: 460 SKPAGFKYKSGQYMFVNFFAASPFEWHPISINSALGDD 347 SKP GFKYKSGQYMFVN A SPFEWHP SI SA GDD Sbjct: 622 SKPQGFKYKSGQYMFVNCAAVSPFEWHPFSITSAPGDD 659 >ref|XP_010250429.1| PREDICTED: respiratory burst oxidase homolog protein C [Nelumbo nucifera] Length = 924 Score = 68.6 bits (166), Expect = 5e-09 Identities = 31/38 (81%), Positives = 31/38 (81%) Frame = -1 Query: 460 SKPAGFKYKSGQYMFVNFFAASPFEWHPISINSALGDD 347 SKP GFKYKSGQYMFVN A SPFEWHP SI SA GDD Sbjct: 628 SKPQGFKYKSGQYMFVNCAAVSPFEWHPFSITSAPGDD 665 >ref|XP_011020924.1| PREDICTED: respiratory burst oxidase homolog protein D [Populus euphratica] Length = 926 Score = 68.6 bits (166), Expect = 5e-09 Identities = 31/38 (81%), Positives = 31/38 (81%) Frame = -1 Query: 460 SKPAGFKYKSGQYMFVNFFAASPFEWHPISINSALGDD 347 SKP GFKYKSGQYMFVN A SPFEWHP SI SA GDD Sbjct: 625 SKPQGFKYKSGQYMFVNCAAVSPFEWHPFSITSAPGDD 662 >ref|XP_002303736.2| hypothetical protein POPTR_0003s15810g [Populus trichocarpa] gb|PNT45873.1| hypothetical protein POPTR_003G159800v3 [Populus trichocarpa] Length = 926 Score = 68.6 bits (166), Expect = 5e-09 Identities = 31/38 (81%), Positives = 31/38 (81%) Frame = -1 Query: 460 SKPAGFKYKSGQYMFVNFFAASPFEWHPISINSALGDD 347 SKP GFKYKSGQYMFVN A SPFEWHP SI SA GDD Sbjct: 625 SKPQGFKYKSGQYMFVNCAAVSPFEWHPFSITSAPGDD 662 >ref|XP_009353482.1| PREDICTED: respiratory burst oxidase homolog protein D-like [Pyrus x bretschneideri] Length = 962 Score = 68.6 bits (166), Expect = 5e-09 Identities = 31/38 (81%), Positives = 31/38 (81%) Frame = -1 Query: 460 SKPAGFKYKSGQYMFVNFFAASPFEWHPISINSALGDD 347 SKP GFKYKSGQYMFVN A SPFEWHP SI SA GDD Sbjct: 655 SKPQGFKYKSGQYMFVNCAAVSPFEWHPFSITSAPGDD 692 >ref|XP_008378424.1| PREDICTED: respiratory burst oxidase homolog protein D-like [Malus domestica] Length = 962 Score = 68.6 bits (166), Expect = 5e-09 Identities = 31/38 (81%), Positives = 31/38 (81%) Frame = -1 Query: 460 SKPAGFKYKSGQYMFVNFFAASPFEWHPISINSALGDD 347 SKP GFKYKSGQYMFVN A SPFEWHP SI SA GDD Sbjct: 655 SKPQGFKYKSGQYMFVNCAAVSPFEWHPFSITSAPGDD 692 >ref|XP_021827478.1| respiratory burst oxidase homolog protein D-like [Prunus avium] Length = 971 Score = 68.6 bits (166), Expect = 5e-09 Identities = 31/38 (81%), Positives = 31/38 (81%) Frame = -1 Query: 460 SKPAGFKYKSGQYMFVNFFAASPFEWHPISINSALGDD 347 SKP GFKYKSGQYMFVN A SPFEWHP SI SA GDD Sbjct: 661 SKPQGFKYKSGQYMFVNCAAVSPFEWHPFSITSAPGDD 698 >ref|XP_008222292.1| PREDICTED: respiratory burst oxidase homolog protein D [Prunus mume] Length = 971 Score = 68.6 bits (166), Expect = 5e-09 Identities = 31/38 (81%), Positives = 31/38 (81%) Frame = -1 Query: 460 SKPAGFKYKSGQYMFVNFFAASPFEWHPISINSALGDD 347 SKP GFKYKSGQYMFVN A SPFEWHP SI SA GDD Sbjct: 661 SKPQGFKYKSGQYMFVNCAAVSPFEWHPFSITSAPGDD 698 >ref|XP_007225362.1| respiratory burst oxidase homolog protein D [Prunus persica] gb|ONI29725.1| hypothetical protein PRUPE_1G211000 [Prunus persica] Length = 971 Score = 68.6 bits (166), Expect = 5e-09 Identities = 31/38 (81%), Positives = 31/38 (81%) Frame = -1 Query: 460 SKPAGFKYKSGQYMFVNFFAASPFEWHPISINSALGDD 347 SKP GFKYKSGQYMFVN A SPFEWHP SI SA GDD Sbjct: 661 SKPQGFKYKSGQYMFVNCAAVSPFEWHPFSITSAPGDD 698