BLASTX nr result
ID: Chrysanthemum22_contig00021651
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00021651 (386 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023751645.1| flowering time control protein FPA [Lactuca ... 57 8e-07 gb|PLY70089.1| hypothetical protein LSAT_4X115121 [Lactuca sativa] 55 1e-06 >ref|XP_023751645.1| flowering time control protein FPA [Lactuca sativa] ref|XP_023751646.1| flowering time control protein FPA [Lactuca sativa] gb|PLY94706.1| hypothetical protein LSAT_2X38600 [Lactuca sativa] Length = 880 Score = 57.0 bits (136), Expect = 8e-07 Identities = 22/30 (73%), Positives = 27/30 (90%) Frame = +1 Query: 292 DFRDSREGKHVRSMAPHDSPWLPPEAVKIY 381 DFRD++EG+H RSM PHDSPWLPP++VK Y Sbjct: 191 DFRDAKEGQHFRSMGPHDSPWLPPDSVKNY 220 >gb|PLY70089.1| hypothetical protein LSAT_4X115121 [Lactuca sativa] Length = 207 Score = 55.5 bits (132), Expect = 1e-06 Identities = 22/30 (73%), Positives = 26/30 (86%) Frame = +1 Query: 292 DFRDSREGKHVRSMAPHDSPWLPPEAVKIY 381 DFRD++EGKH RSM PHDSPWL P++VK Y Sbjct: 163 DFRDAKEGKHFRSMGPHDSPWLAPDSVKKY 192