BLASTX nr result
ID: Chrysanthemum22_contig00021571
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00021571 (409 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022005692.1| nudix hydrolase 13, mitochondrial-like isofo... 59 6e-08 ref|XP_022005691.1| nudix hydrolase 13, mitochondrial-like isofo... 59 6e-08 ref|XP_023740537.1| nudix hydrolase 13, mitochondrial-like [Lact... 59 9e-08 >ref|XP_022005692.1| nudix hydrolase 13, mitochondrial-like isoform X2 [Helianthus annuus] Length = 210 Score = 59.3 bits (142), Expect = 6e-08 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = -3 Query: 404 KEDEDCQLTSTNCHVNGTMTMSTSYGIMLPASIFL 300 +EDEDCQL STNCHV+G MT TSYG+MLPASIFL Sbjct: 178 QEDEDCQLMSTNCHVSGPMT--TSYGVMLPASIFL 210 >ref|XP_022005691.1| nudix hydrolase 13, mitochondrial-like isoform X1 [Helianthus annuus] gb|OTF98976.1| putative NUDIX hydrolase domain-like protein [Helianthus annuus] Length = 216 Score = 59.3 bits (142), Expect = 6e-08 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = -3 Query: 404 KEDEDCQLTSTNCHVNGTMTMSTSYGIMLPASIFL 300 +EDEDCQL STNCHV+G MT TSYG+MLPASIFL Sbjct: 184 QEDEDCQLMSTNCHVSGPMT--TSYGVMLPASIFL 216 >ref|XP_023740537.1| nudix hydrolase 13, mitochondrial-like [Lactuca sativa] gb|PLY96788.1| hypothetical protein LSAT_2X95261 [Lactuca sativa] Length = 221 Score = 58.9 bits (141), Expect = 9e-08 Identities = 28/38 (73%), Positives = 31/38 (81%), Gaps = 3/38 (7%) Frame = -3 Query: 404 KEDEDCQLTSTNCHVNG---TMTMSTSYGIMLPASIFL 300 +EDEDCQL STNCHVNG TM ++ SYGIMLPA IFL Sbjct: 184 QEDEDCQLMSTNCHVNGPIMTMAIANSYGIMLPAGIFL 221