BLASTX nr result
ID: Chrysanthemum22_contig00021505
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00021505 (1430 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KNA14832.1| hypothetical protein SOVF_103850 [Spinacia oleracea] 60 8e-08 ref|XP_010683560.1| PREDICTED: alanine--glyoxylate aminotransfer... 62 2e-06 ref|XP_021850702.1| alanine--glyoxylate aminotransferase 2 homol... 61 3e-06 ref|XP_021987983.1| alanine--glyoxylate aminotransferase 2 homol... 60 5e-06 gb|OTG10522.1| putative alanine-glyoxylate aminotransferase 2 [H... 60 5e-06 >gb|KNA14832.1| hypothetical protein SOVF_103850 [Spinacia oleracea] Length = 72 Score = 59.7 bits (143), Expect = 8e-08 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = -2 Query: 1123 RYQDIISLSNAYHGNVAGTTGATAMCNWKFNLT 1025 R++DI SL NAYHGN AGT GATA CNWKFN+T Sbjct: 6 RWKDITSLRNAYHGNAAGTMGATAQCNWKFNVT 38 >ref|XP_010683560.1| PREDICTED: alanine--glyoxylate aminotransferase 2 homolog 3, mitochondrial [Beta vulgaris subsp. vulgaris] gb|KMT06598.1| hypothetical protein BVRB_7g157660 [Beta vulgaris subsp. vulgaris] Length = 476 Score = 61.6 bits (148), Expect = 2e-06 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = -2 Query: 1117 QDIISLSNAYHGNVAGTTGATAMCNWKFNLTNN 1019 QD+IS+ NAYHGN AGT GATA CNWKFN+T N Sbjct: 181 QDVISIRNAYHGNAAGTMGATAQCNWKFNVTQN 213 >ref|XP_021850702.1| alanine--glyoxylate aminotransferase 2 homolog 3, mitochondrial-like [Spinacia oleracea] gb|KNA04894.1| hypothetical protein SOVF_195320 [Spinacia oleracea] Length = 479 Score = 60.8 bits (146), Expect = 3e-06 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = -2 Query: 1117 QDIISLSNAYHGNVAGTTGATAMCNWKFNLTNN 1019 QDIISL NAYHGN AGT GATA CNWKFN+T + Sbjct: 184 QDIISLRNAYHGNAAGTMGATAQCNWKFNVTQS 216 >ref|XP_021987983.1| alanine--glyoxylate aminotransferase 2 homolog 2, mitochondrial-like [Helianthus annuus] ref|XP_021987984.1| alanine--glyoxylate aminotransferase 2 homolog 2, mitochondrial-like [Helianthus annuus] Length = 481 Score = 60.5 bits (145), Expect = 5e-06 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = -2 Query: 1117 QDIISLSNAYHGNVAGTTGATAMCNWKFNLTNN 1019 QD+ISL NAYHGN AGT GATAMCNWKFN+ + Sbjct: 186 QDVISLRNAYHGNAAGTMGATAMCNWKFNVVQS 218 >gb|OTG10522.1| putative alanine-glyoxylate aminotransferase 2 [Helianthus annuus] Length = 511 Score = 60.5 bits (145), Expect = 5e-06 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = -2 Query: 1117 QDIISLSNAYHGNVAGTTGATAMCNWKFNLTNN 1019 QD+ISL NAYHGN AGT GATAMCNWKFN+ + Sbjct: 186 QDVISLRNAYHGNAAGTMGATAMCNWKFNVVQS 218