BLASTX nr result
ID: Chrysanthemum22_contig00021262
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00021262 (357 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022002799.1| putative ubiquitin-conjugating enzyme E2 38 ... 72 2e-12 ref|XP_022002798.1| putative ubiquitin-conjugating enzyme E2 38 ... 72 2e-12 gb|PLY73395.1| hypothetical protein LSAT_9X96200 [Lactuca sativa] 65 2e-10 ref|XP_023734323.1| probable ubiquitin-conjugating enzyme E2 25 ... 65 6e-10 emb|CBI20306.3| unnamed protein product, partial [Vitis vinifera] 54 7e-10 emb|CBI21855.3| unnamed protein product, partial [Vitis vinifera] 49 3e-09 ref|XP_008367879.1| PREDICTED: putative ubiquitin-conjugating en... 54 3e-09 gb|EEF30672.1| ubiquitin conjugating enzyme, putative [Ricinus c... 63 6e-09 ref|XP_015582423.1| PREDICTED: probable ubiquitin-conjugating en... 63 6e-09 ref|XP_015582422.1| PREDICTED: probable ubiquitin-conjugating en... 63 6e-09 ref|XP_015582420.1| PREDICTED: probable ubiquitin-conjugating en... 63 6e-09 ref|XP_015582419.1| PREDICTED: probable ubiquitin-conjugating en... 63 6e-09 ref|XP_015582417.1| PREDICTED: probable ubiquitin-conjugating en... 63 6e-09 gb|OWM88661.1| hypothetical protein CDL15_Pgr002428 [Punica gran... 62 8e-09 ref|XP_023734321.1| putative ubiquitin-conjugating enzyme E2 38 ... 62 1e-08 ref|XP_023734320.1| probable ubiquitin-conjugating enzyme E2 25 ... 62 1e-08 ref|XP_019194569.1| PREDICTED: putative ubiquitin-conjugating en... 52 2e-08 ref|XP_019194570.1| PREDICTED: putative ubiquitin-conjugating en... 52 2e-08 ref|XP_014631532.1| PREDICTED: putative ubiquitin-conjugating en... 46 3e-08 gb|KHN46082.1| Putative ubiquitin-conjugating enzyme E2 26 [Glyc... 46 3e-08 >ref|XP_022002799.1| putative ubiquitin-conjugating enzyme E2 38 isoform X2 [Helianthus annuus] Length = 511 Score = 72.4 bits (176), Expect = 2e-12 Identities = 30/39 (76%), Positives = 36/39 (92%) Frame = -2 Query: 119 DSDVLRKYRNFKKFDIVDDYSDHHYSATSSAIAQPPRHW 3 ++DVLRKYRNFKKFDIV+DYSDHHYS +SSA +PPR+W Sbjct: 218 NNDVLRKYRNFKKFDIVEDYSDHHYSGSSSATMEPPRNW 256 >ref|XP_022002798.1| putative ubiquitin-conjugating enzyme E2 38 isoform X1 [Helianthus annuus] gb|OTG03458.1| putative ubiquitin-conjugating enzyme 25 [Helianthus annuus] Length = 538 Score = 72.4 bits (176), Expect = 2e-12 Identities = 30/39 (76%), Positives = 36/39 (92%) Frame = -2 Query: 119 DSDVLRKYRNFKKFDIVDDYSDHHYSATSSAIAQPPRHW 3 ++DVLRKYRNFKKFDIV+DYSDHHYS +SSA +PPR+W Sbjct: 245 NNDVLRKYRNFKKFDIVEDYSDHHYSGSSSATMEPPRNW 283 >gb|PLY73395.1| hypothetical protein LSAT_9X96200 [Lactuca sativa] Length = 217 Score = 65.5 bits (158), Expect = 2e-10 Identities = 27/41 (65%), Positives = 34/41 (82%) Frame = -2 Query: 125 GNDSDVLRKYRNFKKFDIVDDYSDHHYSATSSAIAQPPRHW 3 GN+ +VLRKYR FKKFDIV+DYSDH+Y ++S QPPR+W Sbjct: 114 GNNEEVLRKYRKFKKFDIVEDYSDHYYKGSNSEKWQPPRNW 154 >ref|XP_023734323.1| probable ubiquitin-conjugating enzyme E2 25 [Lactuca sativa] Length = 417 Score = 65.5 bits (158), Expect = 6e-10 Identities = 27/41 (65%), Positives = 34/41 (82%) Frame = -2 Query: 125 GNDSDVLRKYRNFKKFDIVDDYSDHHYSATSSAIAQPPRHW 3 GN+ +VLRKYR FKKFDIV+DYSDH+Y ++S QPPR+W Sbjct: 139 GNNEEVLRKYRKFKKFDIVEDYSDHYYKGSNSEKWQPPRNW 179 >emb|CBI20306.3| unnamed protein product, partial [Vitis vinifera] Length = 497 Score = 54.3 bits (129), Expect(2) = 7e-10 Identities = 22/44 (50%), Positives = 30/44 (68%) Frame = -2 Query: 134 GEVGNDSDVLRKYRNFKKFDIVDDYSDHHYSATSSAIAQPPRHW 3 G+ N D+L K+R FK+FD V D+SDHHYS S+ QP ++W Sbjct: 180 GKGRNKDDILNKFRLFKQFDTVQDHSDHHYSCNGSSHTQPSKNW 223 Score = 36.6 bits (83), Expect(2) = 7e-10 Identities = 14/25 (56%), Positives = 20/25 (80%) Frame = -1 Query: 273 YEILQSPYDNIDLPTGIEASIPSVP 199 Y ILQ+ +DN+D+P G+EA IP +P Sbjct: 139 YAILQAHFDNVDIPPGVEAPIPWLP 163 >emb|CBI21855.3| unnamed protein product, partial [Vitis vinifera] Length = 472 Score = 48.9 bits (115), Expect(2) = 3e-09 Identities = 20/38 (52%), Positives = 27/38 (71%) Frame = -2 Query: 116 SDVLRKYRNFKKFDIVDDYSDHHYSATSSAIAQPPRHW 3 +DVL KY FK+FD V+D+SDHH+S QPP++W Sbjct: 186 NDVLGKYLFFKQFDTVEDFSDHHFSRMGFVGEQPPKNW 223 Score = 40.0 bits (92), Expect(2) = 3e-09 Identities = 21/56 (37%), Positives = 33/56 (58%) Frame = -1 Query: 357 DDDVSDSHNGEDYIILXXXXXXXXXXDNYEILQSPYDNIDLPTGIEASIPSVPDIT 190 DDDVS + +D++ D+Y LQ+ +DN+D+P G+EAS+P + D T Sbjct: 125 DDDVSGYDDNDDFLY----------DDDYLKLQAQFDNVDIPPGVEASVPWLKDPT 170 >ref|XP_008367879.1| PREDICTED: putative ubiquitin-conjugating enzyme E2 38 [Malus domestica] ref|XP_008367880.1| PREDICTED: putative ubiquitin-conjugating enzyme E2 38 [Malus domestica] ref|XP_008367881.1| PREDICTED: putative ubiquitin-conjugating enzyme E2 38 [Malus domestica] ref|XP_017186737.1| PREDICTED: putative ubiquitin-conjugating enzyme E2 38 [Malus domestica] Length = 454 Score = 54.3 bits (129), Expect(2) = 3e-09 Identities = 20/40 (50%), Positives = 30/40 (75%) Frame = -2 Query: 122 NDSDVLRKYRNFKKFDIVDDYSDHHYSATSSAIAQPPRHW 3 ND +++K + FKKFD+V+D+SDHH+S + QPPR+W Sbjct: 166 NDDSIMQKSQQFKKFDMVEDFSDHHFSRMGFSDEQPPRYW 205 Score = 34.7 bits (78), Expect(2) = 3e-09 Identities = 18/54 (33%), Positives = 28/54 (51%) Frame = -1 Query: 357 DDDVSDSHNGEDYIILXXXXXXXXXXDNYEILQSPYDNIDLPTGIEASIPSVPD 196 D+D D + D+ D+ LQS +DN+DLP G+EA++P + D Sbjct: 75 DEDNDDDDDDNDFDCDDNDGFLYDDGDDCMTLQSQFDNVDLPPGVEATLPWLND 128 >gb|EEF30672.1| ubiquitin conjugating enzyme, putative [Ricinus communis] Length = 647 Score = 62.8 bits (151), Expect = 6e-09 Identities = 22/40 (55%), Positives = 34/40 (85%) Frame = -2 Query: 122 NDSDVLRKYRNFKKFDIVDDYSDHHYSATSSAIAQPPRHW 3 N+ D+L KY+NFK+FD V+D+SDHHY++ S++ QPP++W Sbjct: 351 NEDDILSKYQNFKRFDTVEDHSDHHYASKGSSVKQPPKNW 390 >ref|XP_015582423.1| PREDICTED: probable ubiquitin-conjugating enzyme E2 26 isoform X5 [Ricinus communis] ref|XP_015582424.1| PREDICTED: probable ubiquitin-conjugating enzyme E2 26 isoform X5 [Ricinus communis] ref|XP_015582425.1| PREDICTED: probable ubiquitin-conjugating enzyme E2 26 isoform X5 [Ricinus communis] ref|XP_015582426.1| PREDICTED: probable ubiquitin-conjugating enzyme E2 26 isoform X5 [Ricinus communis] Length = 650 Score = 62.8 bits (151), Expect = 6e-09 Identities = 22/40 (55%), Positives = 34/40 (85%) Frame = -2 Query: 122 NDSDVLRKYRNFKKFDIVDDYSDHHYSATSSAIAQPPRHW 3 N+ D+L KY+NFK+FD V+D+SDHHY++ S++ QPP++W Sbjct: 354 NEDDILSKYQNFKRFDTVEDHSDHHYASKGSSVKQPPKNW 393 >ref|XP_015582422.1| PREDICTED: probable ubiquitin-conjugating enzyme E2 26 isoform X4 [Ricinus communis] Length = 669 Score = 62.8 bits (151), Expect = 6e-09 Identities = 22/40 (55%), Positives = 34/40 (85%) Frame = -2 Query: 122 NDSDVLRKYRNFKKFDIVDDYSDHHYSATSSAIAQPPRHW 3 N+ D+L KY+NFK+FD V+D+SDHHY++ S++ QPP++W Sbjct: 373 NEDDILSKYQNFKRFDTVEDHSDHHYASKGSSVKQPPKNW 412 >ref|XP_015582420.1| PREDICTED: probable ubiquitin-conjugating enzyme E2 26 isoform X3 [Ricinus communis] Length = 670 Score = 62.8 bits (151), Expect = 6e-09 Identities = 22/40 (55%), Positives = 34/40 (85%) Frame = -2 Query: 122 NDSDVLRKYRNFKKFDIVDDYSDHHYSATSSAIAQPPRHW 3 N+ D+L KY+NFK+FD V+D+SDHHY++ S++ QPP++W Sbjct: 374 NEDDILSKYQNFKRFDTVEDHSDHHYASKGSSVKQPPKNW 413 >ref|XP_015582419.1| PREDICTED: probable ubiquitin-conjugating enzyme E2 26 isoform X2 [Ricinus communis] Length = 673 Score = 62.8 bits (151), Expect = 6e-09 Identities = 22/40 (55%), Positives = 34/40 (85%) Frame = -2 Query: 122 NDSDVLRKYRNFKKFDIVDDYSDHHYSATSSAIAQPPRHW 3 N+ D+L KY+NFK+FD V+D+SDHHY++ S++ QPP++W Sbjct: 377 NEDDILSKYQNFKRFDTVEDHSDHHYASKGSSVKQPPKNW 416 >ref|XP_015582417.1| PREDICTED: probable ubiquitin-conjugating enzyme E2 26 isoform X1 [Ricinus communis] ref|XP_015582418.1| PREDICTED: probable ubiquitin-conjugating enzyme E2 26 isoform X1 [Ricinus communis] Length = 674 Score = 62.8 bits (151), Expect = 6e-09 Identities = 22/40 (55%), Positives = 34/40 (85%) Frame = -2 Query: 122 NDSDVLRKYRNFKKFDIVDDYSDHHYSATSSAIAQPPRHW 3 N+ D+L KY+NFK+FD V+D+SDHHY++ S++ QPP++W Sbjct: 378 NEDDILSKYQNFKRFDTVEDHSDHHYASKGSSVKQPPKNW 417 >gb|OWM88661.1| hypothetical protein CDL15_Pgr002428 [Punica granatum] gb|PKI37627.1| hypothetical protein CRG98_041920 [Punica granatum] Length = 722 Score = 62.4 bits (150), Expect = 8e-09 Identities = 25/46 (54%), Positives = 37/46 (80%), Gaps = 1/46 (2%) Frame = -2 Query: 137 SGEVGNDSD-VLRKYRNFKKFDIVDDYSDHHYSATSSAIAQPPRHW 3 +G+ ND+D V+R++ NFK+FD V D+SDHHYSA+ S++ QPP+ W Sbjct: 408 TGDHSNDTDDVVRRFENFKRFDTVQDHSDHHYSASGSSVKQPPKSW 453 >ref|XP_023734321.1| putative ubiquitin-conjugating enzyme E2 38 isoform X2 [Lactuca sativa] gb|PLY73397.1| hypothetical protein LSAT_9X96180 [Lactuca sativa] Length = 539 Score = 61.6 bits (148), Expect = 1e-08 Identities = 26/45 (57%), Positives = 32/45 (71%) Frame = -2 Query: 137 SGEVGNDSDVLRKYRNFKKFDIVDDYSDHHYSATSSAIAQPPRHW 3 S ++ S+V KY NFKKFDIV+DYSDHHY +S QPPR+W Sbjct: 244 SRKIQQSSNVEEKYPNFKKFDIVEDYSDHHYKGANSETIQPPRNW 288 >ref|XP_023734320.1| probable ubiquitin-conjugating enzyme E2 25 isoform X1 [Lactuca sativa] Length = 564 Score = 61.6 bits (148), Expect = 1e-08 Identities = 26/45 (57%), Positives = 32/45 (71%) Frame = -2 Query: 137 SGEVGNDSDVLRKYRNFKKFDIVDDYSDHHYSATSSAIAQPPRHW 3 S ++ S+V KY NFKKFDIV+DYSDHHY +S QPPR+W Sbjct: 244 SRKIQQSSNVEEKYPNFKKFDIVEDYSDHHYKGANSETIQPPRNW 288 >ref|XP_019194569.1| PREDICTED: putative ubiquitin-conjugating enzyme E2 38 isoform X1 [Ipomoea nil] Length = 444 Score = 52.4 bits (124), Expect(2) = 2e-08 Identities = 21/38 (55%), Positives = 27/38 (71%) Frame = -2 Query: 116 SDVLRKYRNFKKFDIVDDYSDHHYSATSSAIAQPPRHW 3 SD++RKY+ FK FD VDD SDHH++ S QPP+ W Sbjct: 157 SDIIRKYQEFKNFDTVDDCSDHHFNNMDSQGQQPPKAW 194 Score = 33.5 bits (75), Expect(2) = 2e-08 Identities = 16/32 (50%), Positives = 20/32 (62%), Gaps = 6/32 (18%) Frame = -1 Query: 264 LQSPYDNIDLPTGIEASIP------SVPDITD 187 LQ +DN+DLP G+EAS+P S P TD Sbjct: 85 LQKQFDNVDLPPGVEASVPWWKESDSTPASTD 116 >ref|XP_019194570.1| PREDICTED: putative ubiquitin-conjugating enzyme E2 38 isoform X2 [Ipomoea nil] Length = 443 Score = 52.4 bits (124), Expect(2) = 2e-08 Identities = 21/38 (55%), Positives = 27/38 (71%) Frame = -2 Query: 116 SDVLRKYRNFKKFDIVDDYSDHHYSATSSAIAQPPRHW 3 SD++RKY+ FK FD VDD SDHH++ S QPP+ W Sbjct: 156 SDIIRKYQEFKNFDTVDDCSDHHFNNMDSQGQQPPKAW 193 Score = 33.5 bits (75), Expect(2) = 2e-08 Identities = 16/32 (50%), Positives = 20/32 (62%), Gaps = 6/32 (18%) Frame = -1 Query: 264 LQSPYDNIDLPTGIEASIP------SVPDITD 187 LQ +DN+DLP G+EAS+P S P TD Sbjct: 84 LQKQFDNVDLPPGVEASVPWWKESDSTPASTD 115 >ref|XP_014631532.1| PREDICTED: putative ubiquitin-conjugating enzyme E2 38 [Glycine max] Length = 539 Score = 45.8 bits (107), Expect(2) = 3e-08 Identities = 17/39 (43%), Positives = 26/39 (66%) Frame = -2 Query: 119 DSDVLRKYRNFKKFDIVDDYSDHHYSATSSAIAQPPRHW 3 D V++K++ FK+FD VD + DHHY + AQ P++W Sbjct: 221 DDIVMQKFQQFKQFDTVDSFPDHHYDKEGTKDAQKPKNW 259 Score = 39.7 bits (91), Expect(2) = 3e-08 Identities = 20/56 (35%), Positives = 29/56 (51%) Frame = -1 Query: 357 DDDVSDSHNGEDYIILXXXXXXXXXXDNYEILQSPYDNIDLPTGIEASIPSVPDIT 190 D D+ D ED D+Y +Q +DN+DLP G+EAS+P + DI+ Sbjct: 141 DADMIDDDGDEDADYAFDYNDDDIYEDDYSSMQDQFDNVDLPPGVEASLPWLKDIS 196 >gb|KHN46082.1| Putative ubiquitin-conjugating enzyme E2 26 [Glycine soja] Length = 472 Score = 45.8 bits (107), Expect(2) = 3e-08 Identities = 17/39 (43%), Positives = 26/39 (66%) Frame = -2 Query: 119 DSDVLRKYRNFKKFDIVDDYSDHHYSATSSAIAQPPRHW 3 D V++K++ FK+FD VD + DHHY + AQ P++W Sbjct: 154 DDIVMQKFQQFKQFDTVDSFPDHHYDKEGTKDAQKPKNW 192 Score = 39.7 bits (91), Expect(2) = 3e-08 Identities = 20/56 (35%), Positives = 29/56 (51%) Frame = -1 Query: 357 DDDVSDSHNGEDYIILXXXXXXXXXXDNYEILQSPYDNIDLPTGIEASIPSVPDIT 190 D D+ D ED D+Y +Q +DN+DLP G+EAS+P + DI+ Sbjct: 74 DADMIDDDGDEDADYAFDYNDDDIYEDDYSSMQDQFDNVDLPPGVEASLPWLKDIS 129