BLASTX nr result
ID: Chrysanthemum22_contig00021237
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00021237 (392 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_021989786.1| isoleucine--tRNA ligase, cytoplasmic [Helian... 57 9e-07 ref|XP_023756283.1| isoleucine--tRNA ligase, cytoplasmic-like, p... 54 2e-06 gb|PLY91069.1| hypothetical protein LSAT_5X76161 [Lactuca sativa] 54 3e-06 >ref|XP_021989786.1| isoleucine--tRNA ligase, cytoplasmic [Helianthus annuus] gb|OTG12511.1| putative tRNA synthetase class I (I, L, M and V) family protein [Helianthus annuus] Length = 1177 Score = 57.0 bits (136), Expect = 9e-07 Identities = 27/45 (60%), Positives = 36/45 (80%) Frame = +3 Query: 12 LPTHNINVVITEETYKNMSSYDFKITLRRSVLAFNENAILELYSG 146 +P H V+I EETYKN+S+ DF+ITL R+ L FNENAI++LY+G Sbjct: 1071 IPKHA--VIIAEETYKNISNSDFQITLSRAALVFNENAIVDLYAG 1113 >ref|XP_023756283.1| isoleucine--tRNA ligase, cytoplasmic-like, partial [Lactuca sativa] Length = 174 Score = 54.3 bits (129), Expect = 2e-06 Identities = 27/48 (56%), Positives = 36/48 (75%) Frame = +3 Query: 12 LPTHNINVVITEETYKNMSSYDFKITLRRSVLAFNENAILELYSGFAR 155 +P H VVI E+TY+N+S+ DF+ITL R L FN+ AIL+LYSG A+ Sbjct: 66 IPEHA--VVIAEKTYRNISNCDFEITLTRQTLTFNDKAILDLYSGNAK 111 >gb|PLY91069.1| hypothetical protein LSAT_5X76161 [Lactuca sativa] Length = 196 Score = 54.3 bits (129), Expect = 3e-06 Identities = 27/48 (56%), Positives = 36/48 (75%) Frame = +3 Query: 12 LPTHNINVVITEETYKNMSSYDFKITLRRSVLAFNENAILELYSGFAR 155 +P H VVI E+TY+N+S+ DF+ITL R L FN+ AIL+LYSG A+ Sbjct: 88 IPEHA--VVIAEKTYRNISNCDFEITLTRQTLTFNDKAILDLYSGNAK 133