BLASTX nr result
ID: Chrysanthemum22_contig00021073
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00021073 (1454 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVI04274.1| GTP-binding protein TypA [Cynara cardunculus var.... 56 1e-05 >gb|KVI04274.1| GTP-binding protein TypA [Cynara cardunculus var. scolymus] Length = 141 Score = 55.8 bits (133), Expect = 1e-05 Identities = 27/44 (61%), Positives = 34/44 (77%) Frame = +2 Query: 1031 KSKGPTKNAKLLPTRKMSLEEALQFVAYDEEIEVTPHAIRLRKK 1162 +S G +N KL P R+M+LEEA+ +VA DE IEVTPH IRLRK+ Sbjct: 82 RSAGKDENVKLSPPRRMTLEEAIGYVASDELIEVTPHNIRLRKR 125