BLASTX nr result
ID: Chrysanthemum22_contig00020953
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00020953 (387 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PLY78748.1| hypothetical protein LSAT_9X45981 [Lactuca sativa] 45 1e-09 ref|XP_023772539.1| protein ILITYHIA isoform X1 [Lactuca sativa] 45 2e-08 ref|XP_023772540.1| protein ILITYHIA isoform X2 [Lactuca sativa] 45 2e-08 ref|XP_009775450.1| PREDICTED: translational activator GCN1 isof... 43 2e-07 ref|XP_016476858.1| PREDICTED: eIF-2-alpha kinase activator GCN1... 43 2e-07 ref|XP_009775451.1| PREDICTED: translational activator GCN1 isof... 43 2e-07 ref|XP_009775452.1| PREDICTED: translational activator GCN1 isof... 43 2e-07 ref|XP_009587833.1| PREDICTED: eIF-2-alpha kinase activator GCN1... 43 2e-07 ref|XP_016476859.1| PREDICTED: eIF-2-alpha kinase activator GCN1... 43 2e-07 ref|XP_009775453.1| PREDICTED: translational activator GCN1 isof... 43 2e-07 ref|XP_009587842.1| PREDICTED: eIF-2-alpha kinase activator GCN1... 43 2e-07 ref|XP_015073217.1| PREDICTED: translational activator GCN1 [Sol... 43 2e-07 ref|XP_010319822.1| PREDICTED: eIF-2-alpha kinase activator GCN1... 43 2e-07 ref|XP_016550102.1| PREDICTED: LOW QUALITY PROTEIN: eIF-2-alpha ... 43 2e-07 ref|XP_019250941.1| PREDICTED: eIF-2-alpha kinase activator GCN1... 43 2e-07 gb|OIT00142.1| hypothetical protein A4A49_19192 [Nicotiana atten... 43 2e-07 gb|PHT65965.1| hypothetical protein T459_30390, partial [Capsicu... 43 2e-07 ref|XP_016489568.1| PREDICTED: LOW QUALITY PROTEIN: eIF-2-alpha ... 43 2e-07 gb|PHU00604.1| hypothetical protein BC332_30391 [Capsicum chinense] 43 2e-07 ref|XP_015869956.1| PREDICTED: eIF-2-alpha kinase activator GCN1... 43 2e-07 >gb|PLY78748.1| hypothetical protein LSAT_9X45981 [Lactuca sativa] Length = 2612 Score = 44.7 bits (104), Expect(4) = 1e-09 Identities = 31/60 (51%), Positives = 31/60 (51%) Frame = -1 Query: 219 KKMLP*IGLLLPEIKKVFM*RNINFLSV**FMHCRK*VLVDPIPAV*FVVGRAVGSLNRG 40 K MLP IGLLLPEIKKV LVDPIP V V RAVGSL RG Sbjct: 1593 KDMLPYIGLLLPEIKKV---------------------LVDPIPEVRSVAARAVGSLIRG 1631 Score = 32.3 bits (72), Expect(4) = 1e-09 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 41 EDNFPDLVPWLLD 3 E+NFPDLVPWLLD Sbjct: 1634 EENFPDLVPWLLD 1646 Score = 28.1 bits (61), Expect(4) = 1e-09 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -3 Query: 259 QIADNMCFLVTDPK 218 QIA NMC LVTDPK Sbjct: 1580 QIAGNMCSLVTDPK 1593 Score = 23.1 bits (48), Expect(4) = 1e-09 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = -2 Query: 347 YPLDILLQVMSCPIFSSFLIDTIPTIFFHT 258 Y LDILLQ + C +F +D T F ++ Sbjct: 1525 YSLDILLQFLFCRLF----LDLSQTTFINS 1550 >ref|XP_023772539.1| protein ILITYHIA isoform X1 [Lactuca sativa] Length = 2653 Score = 44.7 bits (104), Expect(3) = 2e-08 Identities = 31/60 (51%), Positives = 31/60 (51%) Frame = -1 Query: 219 KKMLP*IGLLLPEIKKVFM*RNINFLSV**FMHCRK*VLVDPIPAV*FVVGRAVGSLNRG 40 K MLP IGLLLPEIKKV LVDPIP V V RAVGSL RG Sbjct: 1634 KDMLPYIGLLLPEIKKV---------------------LVDPIPEVRSVAARAVGSLIRG 1672 Score = 32.3 bits (72), Expect(3) = 2e-08 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 41 EDNFPDLVPWLLD 3 E+NFPDLVPWLLD Sbjct: 1675 EENFPDLVPWLLD 1687 Score = 28.1 bits (61), Expect(3) = 2e-08 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -3 Query: 259 QIADNMCFLVTDPK 218 QIA NMC LVTDPK Sbjct: 1621 QIAGNMCSLVTDPK 1634 >ref|XP_023772540.1| protein ILITYHIA isoform X2 [Lactuca sativa] Length = 2623 Score = 44.7 bits (104), Expect(3) = 2e-08 Identities = 31/60 (51%), Positives = 31/60 (51%) Frame = -1 Query: 219 KKMLP*IGLLLPEIKKVFM*RNINFLSV**FMHCRK*VLVDPIPAV*FVVGRAVGSLNRG 40 K MLP IGLLLPEIKKV LVDPIP V V RAVGSL RG Sbjct: 1604 KDMLPYIGLLLPEIKKV---------------------LVDPIPEVRSVAARAVGSLIRG 1642 Score = 32.3 bits (72), Expect(3) = 2e-08 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 41 EDNFPDLVPWLLD 3 E+NFPDLVPWLLD Sbjct: 1645 EENFPDLVPWLLD 1657 Score = 28.1 bits (61), Expect(3) = 2e-08 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -3 Query: 259 QIADNMCFLVTDPK 218 QIA NMC LVTDPK Sbjct: 1591 QIAGNMCSLVTDPK 1604 >ref|XP_009775450.1| PREDICTED: translational activator GCN1 isoform X1 [Nicotiana sylvestris] Length = 2648 Score = 43.1 bits (100), Expect(3) = 2e-07 Identities = 28/60 (46%), Positives = 31/60 (51%) Frame = -1 Query: 219 KKMLP*IGLLLPEIKKVFM*RNINFLSV**FMHCRK*VLVDPIPAV*FVVGRAVGSLNRG 40 K M+P IGLLLPE+KKV LVDPIP V V RA+GSL RG Sbjct: 1626 KDMIPYIGLLLPEVKKV---------------------LVDPIPEVRSVAARAIGSLIRG 1664 Score = 32.3 bits (72), Expect(3) = 2e-07 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 41 EDNFPDLVPWLLD 3 E+NFPDLVPWLLD Sbjct: 1667 EENFPDLVPWLLD 1679 Score = 26.6 bits (57), Expect(3) = 2e-07 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = -3 Query: 259 QIADNMCFLVTDPK 218 QIA NMC LVT+PK Sbjct: 1613 QIAGNMCSLVTEPK 1626 >ref|XP_016476858.1| PREDICTED: eIF-2-alpha kinase activator GCN1 isoform X1 [Nicotiana tabacum] Length = 2644 Score = 43.1 bits (100), Expect(3) = 2e-07 Identities = 28/60 (46%), Positives = 31/60 (51%) Frame = -1 Query: 219 KKMLP*IGLLLPEIKKVFM*RNINFLSV**FMHCRK*VLVDPIPAV*FVVGRAVGSLNRG 40 K M+P IGLLLPE+KKV LVDPIP V V RA+GSL RG Sbjct: 1626 KDMIPYIGLLLPEVKKV---------------------LVDPIPEVRSVAARAIGSLIRG 1664 Score = 32.3 bits (72), Expect(3) = 2e-07 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 41 EDNFPDLVPWLLD 3 E+NFPDLVPWLLD Sbjct: 1667 EENFPDLVPWLLD 1679 Score = 26.6 bits (57), Expect(3) = 2e-07 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = -3 Query: 259 QIADNMCFLVTDPK 218 QIA NMC LVT+PK Sbjct: 1613 QIAGNMCSLVTEPK 1626 >ref|XP_009775451.1| PREDICTED: translational activator GCN1 isoform X2 [Nicotiana sylvestris] Length = 2644 Score = 43.1 bits (100), Expect(3) = 2e-07 Identities = 28/60 (46%), Positives = 31/60 (51%) Frame = -1 Query: 219 KKMLP*IGLLLPEIKKVFM*RNINFLSV**FMHCRK*VLVDPIPAV*FVVGRAVGSLNRG 40 K M+P IGLLLPE+KKV LVDPIP V V RA+GSL RG Sbjct: 1626 KDMIPYIGLLLPEVKKV---------------------LVDPIPEVRSVAARAIGSLIRG 1664 Score = 32.3 bits (72), Expect(3) = 2e-07 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 41 EDNFPDLVPWLLD 3 E+NFPDLVPWLLD Sbjct: 1667 EENFPDLVPWLLD 1679 Score = 26.6 bits (57), Expect(3) = 2e-07 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = -3 Query: 259 QIADNMCFLVTDPK 218 QIA NMC LVT+PK Sbjct: 1613 QIAGNMCSLVTEPK 1626 >ref|XP_009775452.1| PREDICTED: translational activator GCN1 isoform X3 [Nicotiana sylvestris] Length = 2633 Score = 43.1 bits (100), Expect(3) = 2e-07 Identities = 28/60 (46%), Positives = 31/60 (51%) Frame = -1 Query: 219 KKMLP*IGLLLPEIKKVFM*RNINFLSV**FMHCRK*VLVDPIPAV*FVVGRAVGSLNRG 40 K M+P IGLLLPE+KKV LVDPIP V V RA+GSL RG Sbjct: 1611 KDMIPYIGLLLPEVKKV---------------------LVDPIPEVRSVAARAIGSLIRG 1649 Score = 32.3 bits (72), Expect(3) = 2e-07 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 41 EDNFPDLVPWLLD 3 E+NFPDLVPWLLD Sbjct: 1652 EENFPDLVPWLLD 1664 Score = 26.6 bits (57), Expect(3) = 2e-07 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = -3 Query: 259 QIADNMCFLVTDPK 218 QIA NMC LVT+PK Sbjct: 1598 QIAGNMCSLVTEPK 1611 >ref|XP_009587833.1| PREDICTED: eIF-2-alpha kinase activator GCN1 isoform X1 [Nicotiana tomentosiformis] Length = 2633 Score = 43.1 bits (100), Expect(3) = 2e-07 Identities = 28/60 (46%), Positives = 31/60 (51%) Frame = -1 Query: 219 KKMLP*IGLLLPEIKKVFM*RNINFLSV**FMHCRK*VLVDPIPAV*FVVGRAVGSLNRG 40 K M+P IGLLLPE+KKV LVDPIP V V RA+GSL RG Sbjct: 1611 KDMIPYIGLLLPEVKKV---------------------LVDPIPEVRSVAARAIGSLIRG 1649 Score = 32.3 bits (72), Expect(3) = 2e-07 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 41 EDNFPDLVPWLLD 3 E+NFPDLVPWLLD Sbjct: 1652 EENFPDLVPWLLD 1664 Score = 26.6 bits (57), Expect(3) = 2e-07 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = -3 Query: 259 QIADNMCFLVTDPK 218 QIA NMC LVT+PK Sbjct: 1598 QIAGNMCSLVTEPK 1611 >ref|XP_016476859.1| PREDICTED: eIF-2-alpha kinase activator GCN1 isoform X2 [Nicotiana tabacum] Length = 2629 Score = 43.1 bits (100), Expect(3) = 2e-07 Identities = 28/60 (46%), Positives = 31/60 (51%) Frame = -1 Query: 219 KKMLP*IGLLLPEIKKVFM*RNINFLSV**FMHCRK*VLVDPIPAV*FVVGRAVGSLNRG 40 K M+P IGLLLPE+KKV LVDPIP V V RA+GSL RG Sbjct: 1611 KDMIPYIGLLLPEVKKV---------------------LVDPIPEVRSVAARAIGSLIRG 1649 Score = 32.3 bits (72), Expect(3) = 2e-07 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 41 EDNFPDLVPWLLD 3 E+NFPDLVPWLLD Sbjct: 1652 EENFPDLVPWLLD 1664 Score = 26.6 bits (57), Expect(3) = 2e-07 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = -3 Query: 259 QIADNMCFLVTDPK 218 QIA NMC LVT+PK Sbjct: 1598 QIAGNMCSLVTEPK 1611 >ref|XP_009775453.1| PREDICTED: translational activator GCN1 isoform X4 [Nicotiana sylvestris] Length = 2629 Score = 43.1 bits (100), Expect(3) = 2e-07 Identities = 28/60 (46%), Positives = 31/60 (51%) Frame = -1 Query: 219 KKMLP*IGLLLPEIKKVFM*RNINFLSV**FMHCRK*VLVDPIPAV*FVVGRAVGSLNRG 40 K M+P IGLLLPE+KKV LVDPIP V V RA+GSL RG Sbjct: 1611 KDMIPYIGLLLPEVKKV---------------------LVDPIPEVRSVAARAIGSLIRG 1649 Score = 32.3 bits (72), Expect(3) = 2e-07 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 41 EDNFPDLVPWLLD 3 E+NFPDLVPWLLD Sbjct: 1652 EENFPDLVPWLLD 1664 Score = 26.6 bits (57), Expect(3) = 2e-07 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = -3 Query: 259 QIADNMCFLVTDPK 218 QIA NMC LVT+PK Sbjct: 1598 QIAGNMCSLVTEPK 1611 >ref|XP_009587842.1| PREDICTED: eIF-2-alpha kinase activator GCN1 isoform X2 [Nicotiana tomentosiformis] Length = 2629 Score = 43.1 bits (100), Expect(3) = 2e-07 Identities = 28/60 (46%), Positives = 31/60 (51%) Frame = -1 Query: 219 KKMLP*IGLLLPEIKKVFM*RNINFLSV**FMHCRK*VLVDPIPAV*FVVGRAVGSLNRG 40 K M+P IGLLLPE+KKV LVDPIP V V RA+GSL RG Sbjct: 1611 KDMIPYIGLLLPEVKKV---------------------LVDPIPEVRSVAARAIGSLIRG 1649 Score = 32.3 bits (72), Expect(3) = 2e-07 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 41 EDNFPDLVPWLLD 3 E+NFPDLVPWLLD Sbjct: 1652 EENFPDLVPWLLD 1664 Score = 26.6 bits (57), Expect(3) = 2e-07 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = -3 Query: 259 QIADNMCFLVTDPK 218 QIA NMC LVT+PK Sbjct: 1598 QIAGNMCSLVTEPK 1611 >ref|XP_015073217.1| PREDICTED: translational activator GCN1 [Solanum pennellii] Length = 2628 Score = 43.1 bits (100), Expect(3) = 2e-07 Identities = 28/60 (46%), Positives = 31/60 (51%) Frame = -1 Query: 219 KKMLP*IGLLLPEIKKVFM*RNINFLSV**FMHCRK*VLVDPIPAV*FVVGRAVGSLNRG 40 K M+P IGLLLPE+KKV LVDPIP V V RA+GSL RG Sbjct: 1610 KDMIPYIGLLLPEVKKV---------------------LVDPIPEVRSVAARAIGSLIRG 1648 Score = 32.3 bits (72), Expect(3) = 2e-07 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 41 EDNFPDLVPWLLD 3 E+NFPDLVPWLLD Sbjct: 1651 EENFPDLVPWLLD 1663 Score = 26.6 bits (57), Expect(3) = 2e-07 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = -3 Query: 259 QIADNMCFLVTDPK 218 QIA NMC LVT+PK Sbjct: 1597 QIAGNMCSLVTEPK 1610 >ref|XP_010319822.1| PREDICTED: eIF-2-alpha kinase activator GCN1 [Solanum lycopersicum] Length = 2628 Score = 43.1 bits (100), Expect(3) = 2e-07 Identities = 28/60 (46%), Positives = 31/60 (51%) Frame = -1 Query: 219 KKMLP*IGLLLPEIKKVFM*RNINFLSV**FMHCRK*VLVDPIPAV*FVVGRAVGSLNRG 40 K M+P IGLLLPE+KKV LVDPIP V V RA+GSL RG Sbjct: 1610 KDMIPYIGLLLPEVKKV---------------------LVDPIPEVRSVAARAIGSLIRG 1648 Score = 32.3 bits (72), Expect(3) = 2e-07 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 41 EDNFPDLVPWLLD 3 E+NFPDLVPWLLD Sbjct: 1651 EENFPDLVPWLLD 1663 Score = 26.6 bits (57), Expect(3) = 2e-07 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = -3 Query: 259 QIADNMCFLVTDPK 218 QIA NMC LVT+PK Sbjct: 1597 QIAGNMCSLVTEPK 1610 >ref|XP_016550102.1| PREDICTED: LOW QUALITY PROTEIN: eIF-2-alpha kinase activator GCN1 [Capsicum annuum] Length = 2614 Score = 43.1 bits (100), Expect(3) = 2e-07 Identities = 28/60 (46%), Positives = 31/60 (51%) Frame = -1 Query: 219 KKMLP*IGLLLPEIKKVFM*RNINFLSV**FMHCRK*VLVDPIPAV*FVVGRAVGSLNRG 40 K M+P IGLLLPE+KKV LVDPIP V V RA+GSL RG Sbjct: 1596 KDMIPYIGLLLPEVKKV---------------------LVDPIPEVRSVAARAIGSLIRG 1634 Score = 32.3 bits (72), Expect(3) = 2e-07 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 41 EDNFPDLVPWLLD 3 E+NFPDLVPWLLD Sbjct: 1637 EENFPDLVPWLLD 1649 Score = 26.6 bits (57), Expect(3) = 2e-07 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = -3 Query: 259 QIADNMCFLVTDPK 218 QIA NMC LVT+PK Sbjct: 1583 QIAGNMCSLVTEPK 1596 >ref|XP_019250941.1| PREDICTED: eIF-2-alpha kinase activator GCN1 [Nicotiana attenuata] Length = 2600 Score = 43.1 bits (100), Expect(3) = 2e-07 Identities = 28/60 (46%), Positives = 31/60 (51%) Frame = -1 Query: 219 KKMLP*IGLLLPEIKKVFM*RNINFLSV**FMHCRK*VLVDPIPAV*FVVGRAVGSLNRG 40 K M+P IGLLLPE+KKV LVDPIP V V RA+GSL RG Sbjct: 1582 KDMIPYIGLLLPEVKKV---------------------LVDPIPEVRSVAARAIGSLIRG 1620 Score = 32.3 bits (72), Expect(3) = 2e-07 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 41 EDNFPDLVPWLLD 3 E+NFPDLVPWLLD Sbjct: 1623 EENFPDLVPWLLD 1635 Score = 26.6 bits (57), Expect(3) = 2e-07 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = -3 Query: 259 QIADNMCFLVTDPK 218 QIA NMC LVT+PK Sbjct: 1569 QIAGNMCSLVTEPK 1582 >gb|OIT00142.1| hypothetical protein A4A49_19192 [Nicotiana attenuata] Length = 2553 Score = 43.1 bits (100), Expect(3) = 2e-07 Identities = 28/60 (46%), Positives = 31/60 (51%) Frame = -1 Query: 219 KKMLP*IGLLLPEIKKVFM*RNINFLSV**FMHCRK*VLVDPIPAV*FVVGRAVGSLNRG 40 K M+P IGLLLPE+KKV LVDPIP V V RA+GSL RG Sbjct: 1535 KDMIPYIGLLLPEVKKV---------------------LVDPIPEVRSVAARAIGSLIRG 1573 Score = 32.3 bits (72), Expect(3) = 2e-07 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 41 EDNFPDLVPWLLD 3 E+NFPDLVPWLLD Sbjct: 1576 EENFPDLVPWLLD 1588 Score = 26.6 bits (57), Expect(3) = 2e-07 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = -3 Query: 259 QIADNMCFLVTDPK 218 QIA NMC LVT+PK Sbjct: 1522 QIAGNMCSLVTEPK 1535 >gb|PHT65965.1| hypothetical protein T459_30390, partial [Capsicum annuum] Length = 1991 Score = 43.1 bits (100), Expect(3) = 2e-07 Identities = 28/60 (46%), Positives = 31/60 (51%) Frame = -1 Query: 219 KKMLP*IGLLLPEIKKVFM*RNINFLSV**FMHCRK*VLVDPIPAV*FVVGRAVGSLNRG 40 K M+P IGLLLPE+KKV LVDPIP V V RA+GSL RG Sbjct: 1608 KDMIPYIGLLLPEVKKV---------------------LVDPIPEVRSVAARAIGSLIRG 1646 Score = 32.3 bits (72), Expect(3) = 2e-07 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 41 EDNFPDLVPWLLD 3 E+NFPDLVPWLLD Sbjct: 1649 EENFPDLVPWLLD 1661 Score = 26.6 bits (57), Expect(3) = 2e-07 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = -3 Query: 259 QIADNMCFLVTDPK 218 QIA NMC LVT+PK Sbjct: 1595 QIAGNMCSLVTEPK 1608 >ref|XP_016489568.1| PREDICTED: LOW QUALITY PROTEIN: eIF-2-alpha kinase activator GCN1-like [Nicotiana tabacum] Length = 1957 Score = 43.1 bits (100), Expect(3) = 2e-07 Identities = 28/60 (46%), Positives = 31/60 (51%) Frame = -1 Query: 219 KKMLP*IGLLLPEIKKVFM*RNINFLSV**FMHCRK*VLVDPIPAV*FVVGRAVGSLNRG 40 K M+P IGLLLPE+KKV LVDPIP V V RA+GSL RG Sbjct: 1613 KDMIPYIGLLLPEVKKV---------------------LVDPIPEVRSVAARAIGSLIRG 1651 Score = 32.3 bits (72), Expect(3) = 2e-07 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 41 EDNFPDLVPWLLD 3 E+NFPDLVPWLLD Sbjct: 1654 EENFPDLVPWLLD 1666 Score = 26.6 bits (57), Expect(3) = 2e-07 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = -3 Query: 259 QIADNMCFLVTDPK 218 QIA NMC LVT+PK Sbjct: 1600 QIAGNMCSLVTEPK 1613 >gb|PHU00604.1| hypothetical protein BC332_30391 [Capsicum chinense] Length = 1908 Score = 43.1 bits (100), Expect(3) = 2e-07 Identities = 28/60 (46%), Positives = 31/60 (51%) Frame = -1 Query: 219 KKMLP*IGLLLPEIKKVFM*RNINFLSV**FMHCRK*VLVDPIPAV*FVVGRAVGSLNRG 40 K M+P IGLLLPE+KKV LVDPIP V V RA+GSL RG Sbjct: 1608 KDMIPYIGLLLPEVKKV---------------------LVDPIPEVRSVAARAIGSLIRG 1646 Score = 32.3 bits (72), Expect(3) = 2e-07 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 41 EDNFPDLVPWLLD 3 E+NFPDLVPWLLD Sbjct: 1649 EENFPDLVPWLLD 1661 Score = 26.6 bits (57), Expect(3) = 2e-07 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = -3 Query: 259 QIADNMCFLVTDPK 218 QIA NMC LVT+PK Sbjct: 1595 QIAGNMCSLVTEPK 1608 >ref|XP_015869956.1| PREDICTED: eIF-2-alpha kinase activator GCN1-like, partial [Ziziphus jujuba] Length = 1729 Score = 43.1 bits (100), Expect(3) = 2e-07 Identities = 28/60 (46%), Positives = 31/60 (51%) Frame = -1 Query: 219 KKMLP*IGLLLPEIKKVFM*RNINFLSV**FMHCRK*VLVDPIPAV*FVVGRAVGSLNRG 40 K M+P IGLLLPE+KKV LVDPIP V V RA+GSL RG Sbjct: 1603 KDMIPYIGLLLPEVKKV---------------------LVDPIPEVRSVAARAIGSLIRG 1641 Score = 32.3 bits (72), Expect(3) = 2e-07 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 41 EDNFPDLVPWLLD 3 E+NFPDLVPWLLD Sbjct: 1644 EENFPDLVPWLLD 1656 Score = 26.6 bits (57), Expect(3) = 2e-07 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = -3 Query: 259 QIADNMCFLVTDPK 218 QIA NMC LVT+PK Sbjct: 1590 QIAGNMCSLVTEPK 1603