BLASTX nr result
ID: Chrysanthemum22_contig00020917
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00020917 (378 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008803291.1| PREDICTED: cytochrome P450 704C1-like [Phoen... 62 2e-08 ref|XP_015877968.1| PREDICTED: cytochrome P450 704C1-like [Zizip... 61 2e-08 ref|XP_020692337.1| cytochrome P450 704C1-like [Dendrobium caten... 61 3e-08 ref|XP_010933914.1| PREDICTED: cytochrome P450 704C1-like [Elaei... 60 8e-08 ref|XP_009400464.1| PREDICTED: cytochrome P450 704C1-like [Musa ... 59 1e-07 ref|XP_019703339.1| PREDICTED: cytochrome P450 704C1-like, parti... 58 1e-07 gb|KDO65334.1| hypothetical protein CISIN_1g012536mg [Citrus sin... 59 1e-07 ref|XP_010934572.1| PREDICTED: cytochrome P450 704C1 [Elaeis gui... 59 2e-07 ref|XP_006468806.1| PREDICTED: cytochrome P450 704C1-like [Citru... 59 2e-07 dbj|GAY41313.1| hypothetical protein CUMW_058490 [Citrus unshiu] 59 2e-07 ref|XP_006421783.1| cytochrome P450 704C1 [Citrus clementina] >g... 59 2e-07 dbj|GAY41314.1| hypothetical protein CUMW_058480 [Citrus unshiu] 59 2e-07 ref|XP_020255567.1| cytochrome P450 704C1-like [Asparagus offici... 59 2e-07 gb|ONK79972.1| uncharacterized protein A4U43_C01F12400 [Asparagu... 59 2e-07 ref|XP_002270428.2| PREDICTED: cytochrome P450 704C1 isoform X5 ... 58 3e-07 emb|CBI24485.3| unnamed protein product, partial [Vitis vinifera] 58 3e-07 ref|XP_019081757.1| PREDICTED: cytochrome P450 704C1 isoform X4 ... 58 3e-07 ref|XP_010662357.1| PREDICTED: cytochrome P450 704C1 isoform X3 ... 58 3e-07 ref|XP_010662355.1| PREDICTED: cytochrome P450 704C1 isoform X2 ... 58 3e-07 ref|XP_020571993.1| cytochrome P450 704C1-like [Phalaenopsis equ... 58 3e-07 >ref|XP_008803291.1| PREDICTED: cytochrome P450 704C1-like [Phoenix dactylifera] Length = 506 Score = 61.6 bits (148), Expect = 2e-08 Identities = 30/44 (68%), Positives = 36/44 (81%) Frame = -3 Query: 133 YRHTERFFGDGIFAMDGDK*RHQ*KLASLEFSAKVL*DFSTAIF 2 Y++++ FGDGIFA+DGDK RHQ KLAS EFS KVL DFS A+F Sbjct: 105 YQNSKDLFGDGIFAVDGDKWRHQRKLASYEFSTKVLRDFSGAVF 148 >ref|XP_015877968.1| PREDICTED: cytochrome P450 704C1-like [Ziziphus jujuba] Length = 472 Score = 61.2 bits (147), Expect = 2e-08 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = -3 Query: 112 FGDGIFAMDGDK*RHQ*KLASLEFSAKVL*DFSTAIF 2 FGDGIFA+DGDK RHQ KLAS EFSAKVL DFST++F Sbjct: 78 FGDGIFAVDGDKWRHQRKLASYEFSAKVLRDFSTSVF 114 >ref|XP_020692337.1| cytochrome P450 704C1-like [Dendrobium catenatum] gb|PKU64666.1| Cytochrome P450 704C1 [Dendrobium catenatum] Length = 521 Score = 60.8 bits (146), Expect = 3e-08 Identities = 30/37 (81%), Positives = 32/37 (86%) Frame = -3 Query: 112 FGDGIFAMDGDK*RHQ*KLASLEFSAKVL*DFSTAIF 2 FGDGIFA+DGDK RHQ KLAS EFS KVL DFSTA+F Sbjct: 127 FGDGIFAVDGDKWRHQRKLASYEFSTKVLRDFSTAVF 163 >ref|XP_010933914.1| PREDICTED: cytochrome P450 704C1-like [Elaeis guineensis] Length = 506 Score = 59.7 bits (143), Expect = 8e-08 Identities = 29/44 (65%), Positives = 35/44 (79%) Frame = -3 Query: 133 YRHTERFFGDGIFAMDGDK*RHQ*KLASLEFSAKVL*DFSTAIF 2 Y++ + FGDGIFA+DGDK RHQ KLAS EF+ KVL DFS A+F Sbjct: 105 YQNLKDLFGDGIFAVDGDKWRHQRKLASYEFTTKVLRDFSGAVF 148 >ref|XP_009400464.1| PREDICTED: cytochrome P450 704C1-like [Musa acuminata subsp. malaccensis] Length = 504 Score = 59.3 bits (142), Expect = 1e-07 Identities = 30/44 (68%), Positives = 34/44 (77%) Frame = -3 Query: 133 YRHTERFFGDGIFAMDGDK*RHQ*KLASLEFSAKVL*DFSTAIF 2 Y +T+ FGDGIFA+DGDK RHQ KLAS FS KVL +FS AIF Sbjct: 102 YGNTKELFGDGIFAVDGDKWRHQRKLASFGFSTKVLREFSGAIF 145 >ref|XP_019703339.1| PREDICTED: cytochrome P450 704C1-like, partial [Elaeis guineensis] Length = 195 Score = 57.8 bits (138), Expect = 1e-07 Identities = 29/44 (65%), Positives = 33/44 (75%) Frame = -3 Query: 133 YRHTERFFGDGIFAMDGDK*RHQ*KLASLEFSAKVL*DFSTAIF 2 Y+ FGDGIFA+DGD+ RHQ KLAS EFS KVL DFS A+F Sbjct: 127 YQIINDLFGDGIFAVDGDRWRHQRKLASYEFSTKVLRDFSGAVF 170 >gb|KDO65334.1| hypothetical protein CISIN_1g012536mg [Citrus sinensis] Length = 461 Score = 58.9 bits (141), Expect = 1e-07 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = -3 Query: 112 FGDGIFAMDGDK*RHQ*KLASLEFSAKVL*DFSTAIF 2 FGDGIFA+DGDK RHQ KLAS EFS K+L DFS+A+F Sbjct: 68 FGDGIFAVDGDKWRHQRKLASYEFSTKILRDFSSAVF 104 >ref|XP_010934572.1| PREDICTED: cytochrome P450 704C1 [Elaeis guineensis] Length = 522 Score = 58.9 bits (141), Expect = 2e-07 Identities = 29/44 (65%), Positives = 34/44 (77%) Frame = -3 Query: 133 YRHTERFFGDGIFAMDGDK*RHQ*KLASLEFSAKVL*DFSTAIF 2 YR + FGDGIFA+DG+K RHQ KLAS EFS KVL DFS+ +F Sbjct: 119 YRIMKDLFGDGIFAVDGEKWRHQRKLASYEFSTKVLRDFSSVVF 162 >ref|XP_006468806.1| PREDICTED: cytochrome P450 704C1-like [Citrus sinensis] ref|XP_006490272.1| PREDICTED: cytochrome P450 704C1-like [Citrus sinensis] ref|XP_006490718.1| PREDICTED: cytochrome P450 704C1-like [Citrus sinensis] Length = 523 Score = 58.9 bits (141), Expect = 2e-07 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = -3 Query: 112 FGDGIFAMDGDK*RHQ*KLASLEFSAKVL*DFSTAIF 2 FGDGIFA+DGDK RHQ KLAS EFS K+L DFS+A+F Sbjct: 130 FGDGIFAVDGDKWRHQRKLASYEFSTKILRDFSSAVF 166 >dbj|GAY41313.1| hypothetical protein CUMW_058490 [Citrus unshiu] Length = 527 Score = 58.9 bits (141), Expect = 2e-07 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = -3 Query: 112 FGDGIFAMDGDK*RHQ*KLASLEFSAKVL*DFSTAIF 2 FGDGIFA+DGDK RHQ KLAS EFS K+L DFS+A+F Sbjct: 134 FGDGIFAVDGDKWRHQRKLASYEFSTKILRDFSSAVF 170 >ref|XP_006421783.1| cytochrome P450 704C1 [Citrus clementina] gb|ESR35023.1| hypothetical protein CICLE_v10004720mg [Citrus clementina] Length = 527 Score = 58.9 bits (141), Expect = 2e-07 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = -3 Query: 112 FGDGIFAMDGDK*RHQ*KLASLEFSAKVL*DFSTAIF 2 FGDGIFA+DGDK RHQ KLAS EFS K+L DFS+A+F Sbjct: 134 FGDGIFAVDGDKWRHQRKLASYEFSTKILRDFSSAVF 170 >dbj|GAY41314.1| hypothetical protein CUMW_058480 [Citrus unshiu] Length = 530 Score = 58.9 bits (141), Expect = 2e-07 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = -3 Query: 112 FGDGIFAMDGDK*RHQ*KLASLEFSAKVL*DFSTAIF 2 FGDGIFA+DGDK RHQ KLAS EFS K+L DFS+A+F Sbjct: 134 FGDGIFAVDGDKWRHQRKLASYEFSTKILRDFSSAVF 170 >ref|XP_020255567.1| cytochrome P450 704C1-like [Asparagus officinalis] Length = 454 Score = 58.5 bits (140), Expect = 2e-07 Identities = 27/44 (61%), Positives = 34/44 (77%) Frame = -3 Query: 133 YRHTERFFGDGIFAMDGDK*RHQ*KLASLEFSAKVL*DFSTAIF 2 Y ++ FGDGIFA+DGDK RHQ K+AS EFS +VL DFS+ +F Sbjct: 106 YENSSDLFGDGIFAVDGDKWRHQRKIASYEFSTRVLRDFSSTVF 149 >gb|ONK79972.1| uncharacterized protein A4U43_C01F12400 [Asparagus officinalis] Length = 499 Score = 58.5 bits (140), Expect = 2e-07 Identities = 27/44 (61%), Positives = 34/44 (77%) Frame = -3 Query: 133 YRHTERFFGDGIFAMDGDK*RHQ*KLASLEFSAKVL*DFSTAIF 2 Y ++ FGDGIFA+DGDK RHQ K+AS EFS +VL DFS+ +F Sbjct: 106 YENSSDLFGDGIFAVDGDKWRHQRKIASYEFSTRVLRDFSSTVF 149 >ref|XP_002270428.2| PREDICTED: cytochrome P450 704C1 isoform X5 [Vitis vinifera] Length = 474 Score = 58.2 bits (139), Expect = 3e-07 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = -3 Query: 112 FGDGIFAMDGDK*RHQ*KLASLEFSAKVL*DFSTAIF 2 FGDGIFA+DG+K RHQ KLAS EFS KVL DFST++F Sbjct: 80 FGDGIFAVDGEKWRHQRKLASYEFSTKVLRDFSTSVF 116 >emb|CBI24485.3| unnamed protein product, partial [Vitis vinifera] Length = 493 Score = 58.2 bits (139), Expect = 3e-07 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = -3 Query: 112 FGDGIFAMDGDK*RHQ*KLASLEFSAKVL*DFSTAIF 2 FGDGIFA+DG+K RHQ KLAS EFS KVL DFST++F Sbjct: 80 FGDGIFAVDGEKWRHQRKLASYEFSTKVLRDFSTSVF 116 >ref|XP_019081757.1| PREDICTED: cytochrome P450 704C1 isoform X4 [Vitis vinifera] Length = 496 Score = 58.2 bits (139), Expect = 3e-07 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = -3 Query: 112 FGDGIFAMDGDK*RHQ*KLASLEFSAKVL*DFSTAIF 2 FGDGIFA+DG+K RHQ KLAS EFS KVL DFST++F Sbjct: 102 FGDGIFAVDGEKWRHQRKLASYEFSTKVLRDFSTSVF 138 >ref|XP_010662357.1| PREDICTED: cytochrome P450 704C1 isoform X3 [Vitis vinifera] ref|XP_019081756.1| PREDICTED: cytochrome P450 704C1 isoform X3 [Vitis vinifera] Length = 497 Score = 58.2 bits (139), Expect = 3e-07 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = -3 Query: 112 FGDGIFAMDGDK*RHQ*KLASLEFSAKVL*DFSTAIF 2 FGDGIFA+DG+K RHQ KLAS EFS KVL DFST++F Sbjct: 103 FGDGIFAVDGEKWRHQRKLASYEFSTKVLRDFSTSVF 139 >ref|XP_010662355.1| PREDICTED: cytochrome P450 704C1 isoform X2 [Vitis vinifera] Length = 513 Score = 58.2 bits (139), Expect = 3e-07 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = -3 Query: 112 FGDGIFAMDGDK*RHQ*KLASLEFSAKVL*DFSTAIF 2 FGDGIFA+DG+K RHQ KLAS EFS KVL DFST++F Sbjct: 119 FGDGIFAVDGEKWRHQRKLASYEFSTKVLRDFSTSVF 155 >ref|XP_020571993.1| cytochrome P450 704C1-like [Phalaenopsis equestris] Length = 521 Score = 58.2 bits (139), Expect = 3e-07 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = -3 Query: 112 FGDGIFAMDGDK*RHQ*KLASLEFSAKVL*DFSTAIF 2 FGDGIFA+DG+K +HQ KLAS EFS KVL DFSTA+F Sbjct: 127 FGDGIFAVDGEKWKHQRKLASYEFSTKVLRDFSTAVF 163