BLASTX nr result
ID: Chrysanthemum22_contig00020266
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00020266 (374 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023731840.1| late embryogenesis abundant protein At5g1716... 59 1e-08 >ref|XP_023731840.1| late embryogenesis abundant protein At5g17165-like [Lactuca sativa] gb|PLY99698.1| hypothetical protein LSAT_0X9440 [Lactuca sativa] Length = 124 Score = 58.9 bits (141), Expect = 1e-08 Identities = 27/42 (64%), Positives = 32/42 (76%) Frame = +3 Query: 54 ESAYENGVEDKVNLEVSQVEEMTRKHREYWEPDPDTGLFIRA 179 ESAYE VED+V EVS V E+T K EYWEPDP+TG+F+ A Sbjct: 32 ESAYEKEVEDEVECEVSAVGEITDKPEEYWEPDPETGVFVPA 73