BLASTX nr result
ID: Chrysanthemum22_contig00020069
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00020069 (437 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVH93819.1| DNA-binding, integrase-type [Cynara cardunculus v... 59 2e-07 >gb|KVH93819.1| DNA-binding, integrase-type [Cynara cardunculus var. scolymus] Length = 322 Score = 58.9 bits (141), Expect = 2e-07 Identities = 26/39 (66%), Positives = 32/39 (82%) Frame = -3 Query: 435 EEAAPVTKVEVGEPTASENGCSSVEANEAKPSWEEIKIE 319 +++ PVTKVE G TA+ENGC VE +EA+PSWEEIKIE Sbjct: 284 DDSVPVTKVEAGGATAAENGCPVVEVSEAQPSWEEIKIE 322