BLASTX nr result
ID: Chrysanthemum22_contig00019993
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00019993 (465 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023772962.1| transcription factor PRE6-like [Lactuca sati... 52 4e-06 ref|XP_022007049.1| transcription factor PRE6-like [Helianthus a... 52 4e-06 gb|KVI09118.1| Myc-type, basic helix-loop-helix (bHLH) domain-co... 52 4e-06 ref|XP_022026425.1| transcription factor PRE6-like [Helianthus a... 52 5e-06 >ref|XP_023772962.1| transcription factor PRE6-like [Lactuca sativa] gb|PLY78449.1| hypothetical protein LSAT_2X88961 [Lactuca sativa] Length = 88 Score = 52.4 bits (124), Expect = 4e-06 Identities = 30/47 (63%), Positives = 30/47 (63%) Frame = -2 Query: 293 ASASKVLQETCNYVRSLHKEVXXXXXXXXXXXXXXXXXSPQASIIRS 153 ASASKVLQETCNYVRSLHKEV SPQASIIRS Sbjct: 39 ASASKVLQETCNYVRSLHKEVDDLSDRLSQLLSTIDDNSPQASIIRS 85 >ref|XP_022007049.1| transcription factor PRE6-like [Helianthus annuus] gb|OTF98825.1| putative myc-type, basic helix-loop-helix (bHLH) domain-containing protein [Helianthus annuus] Length = 88 Score = 52.4 bits (124), Expect = 4e-06 Identities = 30/47 (63%), Positives = 30/47 (63%) Frame = -2 Query: 293 ASASKVLQETCNYVRSLHKEVXXXXXXXXXXXXXXXXXSPQASIIRS 153 ASASKVLQETCNYVRSLHKEV SPQASIIRS Sbjct: 39 ASASKVLQETCNYVRSLHKEVDDLSDRLSRLLSTIDDDSPQASIIRS 85 >gb|KVI09118.1| Myc-type, basic helix-loop-helix (bHLH) domain-containing protein [Cynara cardunculus var. scolymus] Length = 88 Score = 52.4 bits (124), Expect = 4e-06 Identities = 30/47 (63%), Positives = 30/47 (63%) Frame = -2 Query: 293 ASASKVLQETCNYVRSLHKEVXXXXXXXXXXXXXXXXXSPQASIIRS 153 ASASKVLQETCNYVRSLHKEV SPQASIIRS Sbjct: 39 ASASKVLQETCNYVRSLHKEVDDLSDRLSQLLSTIDDDSPQASIIRS 85 >ref|XP_022026425.1| transcription factor PRE6-like [Helianthus annuus] gb|OTG35397.1| putative BANQUO 2 [Helianthus annuus] Length = 90 Score = 52.4 bits (124), Expect = 5e-06 Identities = 30/47 (63%), Positives = 30/47 (63%) Frame = -2 Query: 293 ASASKVLQETCNYVRSLHKEVXXXXXXXXXXXXXXXXXSPQASIIRS 153 ASASKVLQETCNYVRSLHKEV SPQASIIRS Sbjct: 39 ASASKVLQETCNYVRSLHKEVDDLSDRLSRLLSTIDDDSPQASIIRS 85