BLASTX nr result
ID: Chrysanthemum22_contig00019726
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00019726 (818 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PON49930.1| Alpha-N-methyltransferase NTM [Trema orientalis] 56 5e-06 >gb|PON49930.1| Alpha-N-methyltransferase NTM [Trema orientalis] Length = 147 Score = 55.8 bits (133), Expect = 5e-06 Identities = 23/65 (35%), Positives = 36/65 (55%) Frame = -1 Query: 794 LGPFPSLITDTESTKHSTRISAATEVSGSDGMGREFKSPDEMWXXXXXXXXXXXDWYRNG 615 + P +++++ + TR+ A+ EV G D GR+FK+ DEMW +WYR G Sbjct: 23 VAPLLKAPSESDTVRSRTRVRASMEVGGLDSEGRQFKNADEMWTEHVGDPTKKTEWYRQG 82 Query: 614 VAYWQ 600 V YW+ Sbjct: 83 VGYWE 87