BLASTX nr result
ID: Chrysanthemum22_contig00019493
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00019493 (774 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PLY94900.1| hypothetical protein LSAT_4X70101 [Lactuca sativa] 77 3e-12 ref|XP_023751265.1| serine/threonine-protein kinase STY46 [Lactu... 77 3e-12 ref|XP_021988928.1| serine/threonine-protein kinase STY46-like i... 77 3e-12 ref|XP_021988927.1| serine/threonine-protein kinase STY46-like i... 77 3e-12 ref|XP_022896681.1| serine/threonine-protein kinase STY46-like i... 76 6e-12 gb|KVH96546.1| ACT domain-containing protein [Cynara cardunculus... 75 8e-12 gb|KVI04065.1| ACT domain-containing protein [Cynara cardunculus... 75 1e-11 gb|PPD77494.1| hypothetical protein GOBAR_DD25606 [Gossypium bar... 74 2e-11 gb|PNX93463.1| ACT-like tyrosine kinase family protein, partial ... 71 3e-11 gb|KHF98935.1| serine/threonine-protein kinase/receptor protein ... 74 3e-11 gb|KJB15877.1| hypothetical protein B456_002G201200 [Gossypium r... 74 3e-11 gb|KJB15878.1| hypothetical protein B456_002G201200 [Gossypium r... 74 3e-11 gb|KJB12133.1| hypothetical protein B456_002G002100 [Gossypium r... 74 3e-11 ref|XP_016715549.1| PREDICTED: serine/threonine-protein kinase S... 74 4e-11 ref|XP_012449493.1| PREDICTED: dual specificity protein kinase s... 74 4e-11 ref|XP_016715548.1| PREDICTED: serine/threonine-protein kinase S... 74 4e-11 ref|XP_012449485.1| PREDICTED: dual specificity protein kinase s... 74 4e-11 ref|XP_017642550.1| PREDICTED: serine/threonine-protein kinase S... 74 4e-11 gb|KJB15880.1| hypothetical protein B456_002G201200 [Gossypium r... 74 4e-11 gb|PPD90766.1| hypothetical protein GOBAR_DD12283 [Gossypium bar... 74 4e-11 >gb|PLY94900.1| hypothetical protein LSAT_4X70101 [Lactuca sativa] Length = 565 Score = 76.6 bits (187), Expect = 3e-12 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = +1 Query: 1 LTALLAEVGLNIQEAHAFSTVDRYSLDVFVVDGWPYK 111 LTALLAEVGLNIQEAHAFSTVDRYSLDVFVVDGWPY+ Sbjct: 190 LTALLAEVGLNIQEAHAFSTVDRYSLDVFVVDGWPYE 226 >ref|XP_023751265.1| serine/threonine-protein kinase STY46 [Lactuca sativa] Length = 567 Score = 76.6 bits (187), Expect = 3e-12 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = +1 Query: 1 LTALLAEVGLNIQEAHAFSTVDRYSLDVFVVDGWPYK 111 LTALLAEVGLNIQEAHAFSTVDRYSLDVFVVDGWPY+ Sbjct: 192 LTALLAEVGLNIQEAHAFSTVDRYSLDVFVVDGWPYE 228 >ref|XP_021988928.1| serine/threonine-protein kinase STY46-like isoform X2 [Helianthus annuus] gb|OTG11583.1| putative ACT-like protein tyrosine kinase family protein [Helianthus annuus] Length = 573 Score = 76.6 bits (187), Expect = 3e-12 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = +1 Query: 1 LTALLAEVGLNIQEAHAFSTVDRYSLDVFVVDGWPYK 111 LTALLAEVGLNIQEAHAFSTVDRYSLDVFVVDGWPY+ Sbjct: 198 LTALLAEVGLNIQEAHAFSTVDRYSLDVFVVDGWPYE 234 >ref|XP_021988927.1| serine/threonine-protein kinase STY46-like isoform X1 [Helianthus annuus] Length = 582 Score = 76.6 bits (187), Expect = 3e-12 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = +1 Query: 1 LTALLAEVGLNIQEAHAFSTVDRYSLDVFVVDGWPYK 111 LTALLAEVGLNIQEAHAFSTVDRYSLDVFVVDGWPY+ Sbjct: 198 LTALLAEVGLNIQEAHAFSTVDRYSLDVFVVDGWPYE 234 >ref|XP_022896681.1| serine/threonine-protein kinase STY46-like isoform X2 [Olea europaea var. sylvestris] Length = 545 Score = 75.9 bits (185), Expect = 6e-12 Identities = 37/45 (82%), Positives = 39/45 (86%) Frame = +1 Query: 1 LTALLAEVGLNIQEAHAFSTVDRYSLDVFVVDGWPYKTCF*MILH 135 LT+LLAEVGLNIQEAHAFSTVD YSLDVFVVDGWP + CF LH Sbjct: 184 LTSLLAEVGLNIQEAHAFSTVDGYSLDVFVVDGWPCEKCFWPHLH 228 >gb|KVH96546.1| ACT domain-containing protein [Cynara cardunculus var. scolymus] Length = 574 Score = 75.5 bits (184), Expect = 8e-12 Identities = 35/37 (94%), Positives = 37/37 (100%) Frame = +1 Query: 1 LTALLAEVGLNIQEAHAFSTVDRYSLDVFVVDGWPYK 111 LT+LLAEVGLNIQEAHAFSTVDRYSLDVFVVDGWPY+ Sbjct: 195 LTSLLAEVGLNIQEAHAFSTVDRYSLDVFVVDGWPYE 231 >gb|KVI04065.1| ACT domain-containing protein [Cynara cardunculus var. scolymus] Length = 578 Score = 75.1 bits (183), Expect = 1e-11 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = +1 Query: 1 LTALLAEVGLNIQEAHAFSTVDRYSLDVFVVDGWPYK 111 LT LLAEVGLNIQEAHAFSTVDRYSLDVFVVDGWPY+ Sbjct: 200 LTCLLAEVGLNIQEAHAFSTVDRYSLDVFVVDGWPYE 236 >gb|PPD77494.1| hypothetical protein GOBAR_DD25606 [Gossypium barbadense] Length = 337 Score = 73.6 bits (179), Expect = 2e-11 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = +1 Query: 1 LTALLAEVGLNIQEAHAFSTVDRYSLDVFVVDGWPYK 111 LTALLAE+GLNIQEAHAFSTVD YSLDVFVVDGWPY+ Sbjct: 181 LTALLAEIGLNIQEAHAFSTVDGYSLDVFVVDGWPYE 217 >gb|PNX93463.1| ACT-like tyrosine kinase family protein, partial [Trifolium pratense] Length = 178 Score = 70.9 bits (172), Expect = 3e-11 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = +1 Query: 1 LTALLAEVGLNIQEAHAFSTVDRYSLDVFVVDGWPYK 111 LTALLAEVGLNIQEAHAFST D YSLDVFVV+GWPY+ Sbjct: 110 LTALLAEVGLNIQEAHAFSTTDGYSLDVFVVEGWPYE 146 >gb|KHF98935.1| serine/threonine-protein kinase/receptor protein [Gossypium arboreum] Length = 433 Score = 73.6 bits (179), Expect = 3e-11 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = +1 Query: 1 LTALLAEVGLNIQEAHAFSTVDRYSLDVFVVDGWPYK 111 LTALLAE+GLNIQEAHAFSTVD YSLDVFVVDGWPY+ Sbjct: 181 LTALLAEIGLNIQEAHAFSTVDGYSLDVFVVDGWPYE 217 >gb|KJB15877.1| hypothetical protein B456_002G201200 [Gossypium raimondii] Length = 456 Score = 73.6 bits (179), Expect = 3e-11 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = +1 Query: 1 LTALLAEVGLNIQEAHAFSTVDRYSLDVFVVDGWPYK 111 LTALLAE+GLNIQEAHAFSTVD YSLDVFVVDGWPY+ Sbjct: 94 LTALLAEIGLNIQEAHAFSTVDGYSLDVFVVDGWPYE 130 >gb|KJB15878.1| hypothetical protein B456_002G201200 [Gossypium raimondii] Length = 473 Score = 73.6 bits (179), Expect = 3e-11 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = +1 Query: 1 LTALLAEVGLNIQEAHAFSTVDRYSLDVFVVDGWPYK 111 LTALLAE+GLNIQEAHAFSTVD YSLDVFVVDGWPY+ Sbjct: 94 LTALLAEIGLNIQEAHAFSTVDGYSLDVFVVDGWPYE 130 >gb|KJB12133.1| hypothetical protein B456_002G002100 [Gossypium raimondii] Length = 473 Score = 73.6 bits (179), Expect = 3e-11 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = +1 Query: 1 LTALLAEVGLNIQEAHAFSTVDRYSLDVFVVDGWPYK 111 LTALLAE+GLNIQEAHAFSTVD YSLDVFVVDGWPY+ Sbjct: 102 LTALLAEIGLNIQEAHAFSTVDGYSLDVFVVDGWPYE 138 >ref|XP_016715549.1| PREDICTED: serine/threonine-protein kinase STY46-like isoform X2 [Gossypium hirsutum] Length = 525 Score = 73.6 bits (179), Expect = 4e-11 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = +1 Query: 1 LTALLAEVGLNIQEAHAFSTVDRYSLDVFVVDGWPYK 111 LTALLAE+GLNIQEAHAFSTVD YSLDVFVVDGWPY+ Sbjct: 181 LTALLAEIGLNIQEAHAFSTVDGYSLDVFVVDGWPYE 217 >ref|XP_012449493.1| PREDICTED: dual specificity protein kinase splB-like isoform X2 [Gossypium raimondii] Length = 526 Score = 73.6 bits (179), Expect = 4e-11 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = +1 Query: 1 LTALLAEVGLNIQEAHAFSTVDRYSLDVFVVDGWPYK 111 LTALLAE+GLNIQEAHAFSTVD YSLDVFVVDGWPY+ Sbjct: 181 LTALLAEIGLNIQEAHAFSTVDGYSLDVFVVDGWPYE 217 >ref|XP_016715548.1| PREDICTED: serine/threonine-protein kinase STY46-like isoform X1 [Gossypium hirsutum] ref|XP_016715550.1| PREDICTED: serine/threonine-protein kinase STY46-like isoform X3 [Gossypium hirsutum] Length = 552 Score = 73.6 bits (179), Expect = 4e-11 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = +1 Query: 1 LTALLAEVGLNIQEAHAFSTVDRYSLDVFVVDGWPYK 111 LTALLAE+GLNIQEAHAFSTVD YSLDVFVVDGWPY+ Sbjct: 181 LTALLAEIGLNIQEAHAFSTVDGYSLDVFVVDGWPYE 217 >ref|XP_012449485.1| PREDICTED: dual specificity protein kinase splB-like isoform X1 [Gossypium raimondii] gb|KJB12132.1| hypothetical protein B456_002G002100 [Gossypium raimondii] Length = 552 Score = 73.6 bits (179), Expect = 4e-11 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = +1 Query: 1 LTALLAEVGLNIQEAHAFSTVDRYSLDVFVVDGWPYK 111 LTALLAE+GLNIQEAHAFSTVD YSLDVFVVDGWPY+ Sbjct: 181 LTALLAEIGLNIQEAHAFSTVDGYSLDVFVVDGWPYE 217 >ref|XP_017642550.1| PREDICTED: serine/threonine-protein kinase STY46-like [Gossypium arboreum] Length = 553 Score = 73.6 bits (179), Expect = 4e-11 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = +1 Query: 1 LTALLAEVGLNIQEAHAFSTVDRYSLDVFVVDGWPYK 111 LTALLAE+GLNIQEAHAFSTVD YSLDVFVVDGWPY+ Sbjct: 181 LTALLAEIGLNIQEAHAFSTVDGYSLDVFVVDGWPYE 217 >gb|KJB15880.1| hypothetical protein B456_002G201200 [Gossypium raimondii] Length = 558 Score = 73.6 bits (179), Expect = 4e-11 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = +1 Query: 1 LTALLAEVGLNIQEAHAFSTVDRYSLDVFVVDGWPYK 111 LTALLAE+GLNIQEAHAFSTVD YSLDVFVVDGWPY+ Sbjct: 196 LTALLAEIGLNIQEAHAFSTVDGYSLDVFVVDGWPYE 232 >gb|PPD90766.1| hypothetical protein GOBAR_DD12283 [Gossypium barbadense] Length = 575 Score = 73.6 bits (179), Expect = 4e-11 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = +1 Query: 1 LTALLAEVGLNIQEAHAFSTVDRYSLDVFVVDGWPYK 111 LTALLAE+GLNIQEAHAFSTVD YSLDVFVVDGWPY+ Sbjct: 196 LTALLAEIGLNIQEAHAFSTVDGYSLDVFVVDGWPYE 232