BLASTX nr result
ID: Chrysanthemum22_contig00019353
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00019353 (424 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAA92336.1| type 2A protein phosphatase-III, partial [Vicia ... 57 4e-08 gb|PNY09757.1| serine/threonine protein phosphatase 2A, partial ... 60 7e-08 gb|ONM06571.1| Serine/threonine-protein phosphatase [Zea mays] 57 8e-08 gb|KNA08612.1| hypothetical protein SOVF_161060 isoform A, parti... 57 8e-08 ref|XP_017180235.1| PREDICTED: serine/threonine-protein phosphat... 57 1e-07 gb|AAQ67229.1| protein phosphatase 2A catalytic subunit, partial... 57 1e-07 gb|AAQ67230.1| protein phosphatase 2A catalytic subunit, partial... 57 1e-07 gb|ONL96546.1| Serine/threonine-protein phosphatase PP2A catalyt... 57 2e-07 ref|XP_022874458.1| serine/threonine-protein phosphatase PP2A ca... 57 2e-07 gb|ONL94067.1| Serine/threonine-protein phosphatase PP2A-4 catal... 57 2e-07 ref|XP_017191657.1| PREDICTED: serine/threonine-protein phosphat... 55 2e-07 gb|PIN10967.1| Phosphoprotein phosphatase [Handroanthus impetigi... 57 2e-07 gb|KNA04798.1| hypothetical protein SOVF_196360, partial [Spinac... 54 2e-07 gb|AQL09418.1| Serine/threonine-protein phosphatase [Zea mays] 57 2e-07 ref|XP_018508788.1| PREDICTED: serine/threonine-protein phosphat... 57 3e-07 gb|PPR84812.1| hypothetical protein GOBAR_AA35902 [Gossypium bar... 57 3e-07 ref|XP_013591939.1| PREDICTED: serine/threonine-protein phosphat... 57 3e-07 ref|XP_019242151.1| PREDICTED: serine/threonine-protein phosphat... 57 3e-07 ref|NP_001189732.1| protein phosphatase 2A-3 [Arabidopsis thalia... 57 3e-07 ref|XP_019100583.1| PREDICTED: serine/threonine-protein phosphat... 57 3e-07 >dbj|BAA92336.1| type 2A protein phosphatase-III, partial [Vicia faba] Length = 71 Score = 57.0 bits (136), Expect = 4e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -3 Query: 422 CPDTNYLFMGDYVDRGYYSVETVT 351 CPDTNYLFMGDYVDRGYYSVETVT Sbjct: 14 CPDTNYLFMGDYVDRGYYSVETVT 37 >gb|PNY09757.1| serine/threonine protein phosphatase 2A, partial [Trifolium pratense] Length = 310 Score = 60.1 bits (144), Expect = 7e-08 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = -3 Query: 422 CPDTNYLFMGDYVDRGYYSVETVT*WF*CMLILC 321 CPDTNYLFMGDYVDRGYYSVETVT C L++C Sbjct: 48 CPDTNYLFMGDYVDRGYYSVETVTATI-CFLVVC 80 >gb|ONM06571.1| Serine/threonine-protein phosphatase [Zea mays] Length = 120 Score = 57.4 bits (137), Expect = 8e-08 Identities = 27/35 (77%), Positives = 29/35 (82%) Frame = -3 Query: 422 CPDTNYLFMGDYVDRGYYSVETVT*WF*CMLILCI 318 CPDTNYLFMGDYVDRGYYSVETVT C LI+ + Sbjct: 81 CPDTNYLFMGDYVDRGYYSVETVT--VRCSLIVAL 113 >gb|KNA08612.1| hypothetical protein SOVF_161060 isoform A, partial [Spinacia oleracea] Length = 105 Score = 57.0 bits (136), Expect = 8e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -3 Query: 422 CPDTNYLFMGDYVDRGYYSVETVT 351 CPDTNYLFMGDYVDRGYYSVETVT Sbjct: 72 CPDTNYLFMGDYVDRGYYSVETVT 95 >ref|XP_017180235.1| PREDICTED: serine/threonine-protein phosphatase PP2A catalytic subunit-like [Malus domestica] Length = 114 Score = 57.0 bits (136), Expect = 1e-07 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -3 Query: 422 CPDTNYLFMGDYVDRGYYSVETVT 351 CPDTNYLFMGDYVDRGYYSVETVT Sbjct: 77 CPDTNYLFMGDYVDRGYYSVETVT 100 >gb|AAQ67229.1| protein phosphatase 2A catalytic subunit, partial [Nicotiana benthamiana] Length = 119 Score = 57.0 bits (136), Expect = 1e-07 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -3 Query: 422 CPDTNYLFMGDYVDRGYYSVETVT 351 CPDTNYLFMGDYVDRGYYSVETVT Sbjct: 80 CPDTNYLFMGDYVDRGYYSVETVT 103 >gb|AAQ67230.1| protein phosphatase 2A catalytic subunit, partial [Nicotiana benthamiana] Length = 120 Score = 57.0 bits (136), Expect = 1e-07 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -3 Query: 422 CPDTNYLFMGDYVDRGYYSVETVT 351 CPDTNYLFMGDYVDRGYYSVETVT Sbjct: 80 CPDTNYLFMGDYVDRGYYSVETVT 103 >gb|ONL96546.1| Serine/threonine-protein phosphatase PP2A catalytic subunit [Zea mays] Length = 119 Score = 56.6 bits (135), Expect = 2e-07 Identities = 23/24 (95%), Positives = 24/24 (100%) Frame = -3 Query: 422 CPDTNYLFMGDYVDRGYYSVETVT 351 CPDTNYLFMGDYVDRGYYS+ETVT Sbjct: 73 CPDTNYLFMGDYVDRGYYSIETVT 96 >ref|XP_022874458.1| serine/threonine-protein phosphatase PP2A catalytic subunit-like [Olea europaea var. sylvestris] Length = 142 Score = 57.0 bits (136), Expect = 2e-07 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -3 Query: 422 CPDTNYLFMGDYVDRGYYSVETVT 351 CPDTNYLFMGDYVDRGYYSVETVT Sbjct: 81 CPDTNYLFMGDYVDRGYYSVETVT 104 >gb|ONL94067.1| Serine/threonine-protein phosphatase PP2A-4 catalytic subunit [Zea mays] Length = 148 Score = 57.0 bits (136), Expect = 2e-07 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -3 Query: 422 CPDTNYLFMGDYVDRGYYSVETVT 351 CPDTNYLFMGDYVDRGYYSVETVT Sbjct: 79 CPDTNYLFMGDYVDRGYYSVETVT 102 >ref|XP_017191657.1| PREDICTED: serine/threonine-protein phosphatase PP2A-2 catalytic subunit-like [Malus domestica] Length = 87 Score = 55.5 bits (132), Expect = 2e-07 Identities = 23/24 (95%), Positives = 24/24 (100%) Frame = -3 Query: 422 CPDTNYLFMGDYVDRGYYSVETVT 351 CP+TNYLFMGDYVDRGYYSVETVT Sbjct: 36 CPETNYLFMGDYVDRGYYSVETVT 59 >gb|PIN10967.1| Phosphoprotein phosphatase [Handroanthus impetiginosus] Length = 138 Score = 56.6 bits (135), Expect = 2e-07 Identities = 23/24 (95%), Positives = 24/24 (100%) Frame = -3 Query: 422 CPDTNYLFMGDYVDRGYYSVETVT 351 CPDTNYLFMGDYVDRGYYS+ETVT Sbjct: 77 CPDTNYLFMGDYVDRGYYSIETVT 100 >gb|KNA04798.1| hypothetical protein SOVF_196360, partial [Spinacia oleracea] Length = 27 Score = 53.9 bits (128), Expect = 2e-07 Identities = 22/23 (95%), Positives = 23/23 (100%) Frame = -3 Query: 422 CPDTNYLFMGDYVDRGYYSVETV 354 CPDTNYLFMGDYVDRGYYSVET+ Sbjct: 1 CPDTNYLFMGDYVDRGYYSVETM 23 >gb|AQL09418.1| Serine/threonine-protein phosphatase [Zea mays] Length = 161 Score = 57.0 bits (136), Expect = 2e-07 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -3 Query: 422 CPDTNYLFMGDYVDRGYYSVETVT 351 CPDTNYLFMGDYVDRGYYSVETVT Sbjct: 79 CPDTNYLFMGDYVDRGYYSVETVT 102 >ref|XP_018508788.1| PREDICTED: serine/threonine-protein phosphatase PP2A-3 catalytic subunit-like isoform X2 [Brassica rapa] Length = 164 Score = 57.0 bits (136), Expect = 3e-07 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -3 Query: 422 CPDTNYLFMGDYVDRGYYSVETVT 351 CPDTNYLFMGDYVDRGYYSVETVT Sbjct: 77 CPDTNYLFMGDYVDRGYYSVETVT 100 >gb|PPR84812.1| hypothetical protein GOBAR_AA35902 [Gossypium barbadense] Length = 165 Score = 57.0 bits (136), Expect = 3e-07 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -3 Query: 422 CPDTNYLFMGDYVDRGYYSVETVT 351 CPDTNYLFMGDYVDRGYYSVETVT Sbjct: 31 CPDTNYLFMGDYVDRGYYSVETVT 54 >ref|XP_013591939.1| PREDICTED: serine/threonine-protein phosphatase PP2A-3 catalytic subunit-like isoform X2 [Brassica oleracea var. oleracea] ref|XP_022568767.1| serine/threonine-protein phosphatase PP2A-4 catalytic subunit isoform X2 [Brassica napus] Length = 166 Score = 57.0 bits (136), Expect = 3e-07 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -3 Query: 422 CPDTNYLFMGDYVDRGYYSVETVT 351 CPDTNYLFMGDYVDRGYYSVETVT Sbjct: 79 CPDTNYLFMGDYVDRGYYSVETVT 102 >ref|XP_019242151.1| PREDICTED: serine/threonine-protein phosphatase PP2A catalytic subunit-like [Nicotiana attenuata] Length = 168 Score = 57.0 bits (136), Expect = 3e-07 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -3 Query: 422 CPDTNYLFMGDYVDRGYYSVETVT 351 CPDTNYLFMGDYVDRGYYSVETVT Sbjct: 78 CPDTNYLFMGDYVDRGYYSVETVT 101 >ref|NP_001189732.1| protein phosphatase 2A-3 [Arabidopsis thaliana] gb|AEC10129.1| protein phosphatase 2A-3 [Arabidopsis thaliana] Length = 171 Score = 57.0 bits (136), Expect = 3e-07 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -3 Query: 422 CPDTNYLFMGDYVDRGYYSVETVT 351 CPDTNYLFMGDYVDRGYYSVETVT Sbjct: 82 CPDTNYLFMGDYVDRGYYSVETVT 105 >ref|XP_019100583.1| PREDICTED: serine/threonine-protein phosphatase PP2A-4 catalytic subunit isoform X2 [Camelina sativa] ref|XP_019082343.1| PREDICTED: serine/threonine-protein phosphatase PP2A-4 catalytic subunit isoform X2 [Camelina sativa] Length = 172 Score = 57.0 bits (136), Expect = 3e-07 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -3 Query: 422 CPDTNYLFMGDYVDRGYYSVETVT 351 CPDTNYLFMGDYVDRGYYSVETVT Sbjct: 79 CPDTNYLFMGDYVDRGYYSVETVT 102