BLASTX nr result
ID: Chrysanthemum22_contig00019189
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00019189 (463 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVH90860.1| hypothetical protein Ccrd_007111 [Cynara carduncu... 77 2e-14 ref|XP_022001268.1| serine/arginine-rich SC35-like splicing fact... 69 5e-11 gb|OTF97720.1| putative nucleotide-binding alpha-beta plait doma... 64 3e-09 ref|XP_022009371.1| serine/arginine-rich SC35-like splicing fact... 64 3e-09 ref|XP_023754846.1| serine/arginine-rich SC35-like splicing fact... 64 5e-09 gb|KVI08290.1| hypothetical protein Ccrd_013340 [Cynara carduncu... 62 8e-09 ref|XP_023750253.1| serine/arginine-rich SC35-like splicing fact... 62 1e-08 emb|CDP16795.1| unnamed protein product [Coffea canephora] 62 2e-08 gb|OTG08708.1| hypothetical protein HannXRQ_Chr11g0344741 [Helia... 60 4e-08 ref|XP_021994219.1| serine/arginine-rich SC35-like splicing fact... 60 1e-07 gb|OTG37696.1| putative SC35-like splicing factor 30A [Helianthu... 59 2e-07 ref|XP_021980722.1| serine/arginine-rich SC35-like splicing fact... 59 2e-07 ref|XP_022844148.1| serine/arginine-rich SC35-like splicing fact... 58 4e-07 ref|XP_016506243.1| PREDICTED: serine/arginine repetitive matrix... 56 1e-06 ref|XP_011089133.1| serine/arginine-rich SC35-like splicing fact... 57 1e-06 ref|XP_011089730.1| serine/arginine-rich SC35-like splicing fact... 57 1e-06 gb|KZM86681.1| hypothetical protein DCAR_023815 [Daucus carota s... 56 1e-06 ref|XP_017219214.1| PREDICTED: serine/arginine-rich SC35-like sp... 56 1e-06 ref|XP_017219213.1| PREDICTED: serine/arginine-rich SC35-like sp... 56 2e-06 ref|XP_016472659.1| PREDICTED: serine/arginine-rich SC35-like sp... 56 2e-06 >gb|KVH90860.1| hypothetical protein Ccrd_007111 [Cynara cardunculus var. scolymus] Length = 189 Score = 76.6 bits (187), Expect = 2e-14 Identities = 41/93 (44%), Positives = 50/93 (53%), Gaps = 3/93 (3%) Frame = +1 Query: 142 HYSRSVSPVEKRYSRERSYSGSPVRDRSPSHDGAPRSPSRSPFNG---XXXXXXXXXXXX 312 HYSRS+SP ++RYSRERSYS SPVR+RSPS+ RSP P+ G Sbjct: 97 HYSRSISPRDRRYSRERSYSRSPVRERSPSYRSPSRSPKSPPYKGGSRSRSRSPVRERLP 156 Query: 313 XXXXXXXXXXXXXAEPRDYDRDVPPHRDASASP 411 A+P DY RD+PP RD S +P Sbjct: 157 PRGESRSRSRSRSADPGDYYRDLPPRRDGSPTP 189 >ref|XP_022001268.1| serine/arginine-rich SC35-like splicing factor SCL30A [Helianthus annuus] Length = 264 Score = 68.9 bits (167), Expect = 5e-11 Identities = 45/92 (48%), Positives = 49/92 (53%), Gaps = 3/92 (3%) Frame = +1 Query: 145 YSRSVSPVEKRYSRERSYSGSPVRDRSPSHDGAPRSPSRSPFNGXXXXXXXXXXXXXXXX 324 YSRS+SP +KRYSRERSYSGSPVR SPS +PRSPSRSP Sbjct: 177 YSRSISPRDKRYSRERSYSGSPVR--SPSR--SPRSPSRSPVKERSPPYSEPRSRSPSRS 232 Query: 325 XXXXXXXXXA---EPRDYDRDVPPHRDASASP 411 + EP DY RDVP D SASP Sbjct: 233 PVRSPSRSRSRSGEPGDYYRDVPQRSDGSASP 264 >gb|OTF97720.1| putative nucleotide-binding alpha-beta plait domain-containing protein [Helianthus annuus] Length = 271 Score = 64.3 bits (155), Expect = 3e-09 Identities = 32/45 (71%), Positives = 39/45 (86%), Gaps = 1/45 (2%) Frame = +1 Query: 145 YSRSVSPVEKRYSRERSYSGSPVRDRSPSHDGAPRSPSRS-PFNG 276 ++RSVSP EKR+SRERS S SPVR+RSP +DG+PRS SRS P+NG Sbjct: 171 HTRSVSPQEKRHSRERSLSQSPVRERSPPYDGSPRSRSRSPPYNG 215 >ref|XP_022009371.1| serine/arginine-rich SC35-like splicing factor SCL30A [Helianthus annuus] Length = 285 Score = 64.3 bits (155), Expect = 3e-09 Identities = 32/45 (71%), Positives = 39/45 (86%), Gaps = 1/45 (2%) Frame = +1 Query: 145 YSRSVSPVEKRYSRERSYSGSPVRDRSPSHDGAPRSPSRS-PFNG 276 ++RSVSP EKR+SRERS S SPVR+RSP +DG+PRS SRS P+NG Sbjct: 185 HTRSVSPQEKRHSRERSLSQSPVRERSPPYDGSPRSRSRSPPYNG 229 >ref|XP_023754846.1| serine/arginine-rich SC35-like splicing factor SCL30A [Lactuca sativa] gb|PLY92186.1| hypothetical protein LSAT_6X54241 [Lactuca sativa] Length = 279 Score = 63.5 bits (153), Expect = 5e-09 Identities = 42/101 (41%), Positives = 48/101 (47%), Gaps = 12/101 (11%) Frame = +1 Query: 145 YSRSVSPVEKRYSRERSYSGSPVRDRSPSHDG--APRSP----------SRSPFNGXXXX 288 YSRS++P ++RYSRERSYS SPVR+RS S+D PRSP SRS Sbjct: 179 YSRSITPRDRRYSRERSYSRSPVRERSLSYDDDVPPRSPMRETSPPYSRSRSRSRSPVRE 238 Query: 289 XXXXXXXXXXXXXXXXXXXXXAEPRDYDRDVPPHRDASASP 411 EP Y RDVPP RD S SP Sbjct: 239 QLPVRRGGSRSRSPSRSRSRSGEPGGYYRDVPPRRDDSVSP 279 >gb|KVI08290.1| hypothetical protein Ccrd_013340 [Cynara cardunculus var. scolymus] Length = 216 Score = 62.4 bits (150), Expect = 8e-09 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = +1 Query: 151 RSVSPVEKRYSRERSYSGSPVRDRSPSHDGAPRSPSRSP 267 RS+SP EKR+SRERSYS SPV++RSP +DG PRS SRSP Sbjct: 111 RSISPREKRHSRERSYSQSPVKERSPPYDGPPRSRSRSP 149 >ref|XP_023750253.1| serine/arginine-rich SC35-like splicing factor SCL30A [Lactuca sativa] Length = 282 Score = 62.4 bits (150), Expect = 1e-08 Identities = 30/39 (76%), Positives = 33/39 (84%) Frame = +1 Query: 151 RSVSPVEKRYSRERSYSGSPVRDRSPSHDGAPRSPSRSP 267 RS+SP EKR+SRERSYS SPVR RSP +DG PRS SRSP Sbjct: 186 RSISPREKRHSRERSYSQSPVRPRSPPYDGPPRSRSRSP 224 >emb|CDP16795.1| unnamed protein product [Coffea canephora] Length = 270 Score = 61.6 bits (148), Expect = 2e-08 Identities = 40/93 (43%), Positives = 46/93 (49%), Gaps = 7/93 (7%) Frame = +1 Query: 145 YSRSVSPVEKRYSRERSYSGSPVRDRSPSHDGAPRSPSRS-------PFNGXXXXXXXXX 303 YSRSVSP E+RYSRERSYS SP R+RSP PRS SR+ P+NG Sbjct: 177 YSRSVSPQERRYSRERSYSRSPARERSPPPYDGPRSRSRTPVRELSPPYNGSRSRSRSPV 236 Query: 304 XXXXXXXXXXXXXXXXAEPRDYDRDVPPHRDAS 402 A+P DY RD+ RD S Sbjct: 237 RGQSRSRSPSRSRSRSADPVDYRRDL--DRDGS 267 >gb|OTG08708.1| hypothetical protein HannXRQ_Chr11g0344741 [Helianthus annuus] Length = 175 Score = 59.7 bits (143), Expect = 4e-08 Identities = 30/42 (71%), Positives = 33/42 (78%) Frame = +1 Query: 142 HYSRSVSPVEKRYSRERSYSGSPVRDRSPSHDGAPRSPSRSP 267 H SRSVSP KR+SRERS S SPVR RSP ++G RSPSRSP Sbjct: 74 HQSRSVSPRGKRFSRERSCSRSPVRARSPPYNGGSRSPSRSP 115 >ref|XP_021994219.1| serine/arginine-rich SC35-like splicing factor SCL30A [Helianthus annuus] Length = 274 Score = 59.7 bits (143), Expect = 1e-07 Identities = 30/42 (71%), Positives = 33/42 (78%) Frame = +1 Query: 142 HYSRSVSPVEKRYSRERSYSGSPVRDRSPSHDGAPRSPSRSP 267 H SRSVSP KR+SRERS S SPVR RSP ++G RSPSRSP Sbjct: 173 HQSRSVSPRGKRFSRERSCSRSPVRARSPPYNGGSRSPSRSP 214 >gb|OTG37696.1| putative SC35-like splicing factor 30A [Helianthus annuus] Length = 267 Score = 58.9 bits (141), Expect = 2e-07 Identities = 41/102 (40%), Positives = 47/102 (46%), Gaps = 12/102 (11%) Frame = +1 Query: 142 HYSRSVSPVEKRYSRERSYSGSPVRDRSPSHDGAPRSPSRS--------PFNG----XXX 285 H+SRSVSP KRYSRERSYS SP R SP ++G RS S+S P+NG Sbjct: 167 HHSRSVSPRGKRYSRERSYSPSPARQGSPPYNGGSRSRSQSPVKDRSPPPYNGSRSPSPG 226 Query: 286 XXXXXXXXXXXXXXXXXXXXXXAEPRDYDRDVPPHRDASASP 411 +PRDY R P RD S SP Sbjct: 227 PERARLPPTSRSPSRSRSRSRSPDPRDYPRG-KPDRDGSVSP 267 >ref|XP_021980722.1| serine/arginine-rich SC35-like splicing factor SCL30A [Helianthus annuus] Length = 284 Score = 58.9 bits (141), Expect = 2e-07 Identities = 41/102 (40%), Positives = 47/102 (46%), Gaps = 12/102 (11%) Frame = +1 Query: 142 HYSRSVSPVEKRYSRERSYSGSPVRDRSPSHDGAPRSPSRS--------PFNG----XXX 285 H+SRSVSP KRYSRERSYS SP R SP ++G RS S+S P+NG Sbjct: 184 HHSRSVSPRGKRYSRERSYSPSPARQGSPPYNGGSRSRSQSPVKDRSPPPYNGSRSPSPG 243 Query: 286 XXXXXXXXXXXXXXXXXXXXXXAEPRDYDRDVPPHRDASASP 411 +PRDY R P RD S SP Sbjct: 244 PERARLPPTSRSPSRSRSRSRSPDPRDYPRG-KPDRDGSVSP 284 >ref|XP_022844148.1| serine/arginine-rich SC35-like splicing factor SCL30A [Olea europaea var. sylvestris] Length = 267 Score = 58.2 bits (139), Expect = 4e-07 Identities = 30/44 (68%), Positives = 35/44 (79%) Frame = +1 Query: 145 YSRSVSPVEKRYSRERSYSGSPVRDRSPSHDGAPRSPSRSPFNG 276 YSRSVSP E+RYSRERS+S SP R RSP ++G+ RS SRSP G Sbjct: 171 YSRSVSPRERRYSRERSFSHSPARGRSPPYNGS-RSRSRSPVRG 213 >ref|XP_016506243.1| PREDICTED: serine/arginine repetitive matrix protein 5-like, partial [Nicotiana tabacum] Length = 189 Score = 56.2 bits (134), Expect = 1e-06 Identities = 29/41 (70%), Positives = 34/41 (82%) Frame = +1 Query: 145 YSRSVSPVEKRYSRERSYSGSPVRDRSPSHDGAPRSPSRSP 267 YSRSVSP EKRYSRERSYS SP RD SP ++G+ RS S++P Sbjct: 97 YSRSVSPEEKRYSRERSYSRSPARDISPPYNGS-RSRSQTP 136 >ref|XP_011089133.1| serine/arginine-rich SC35-like splicing factor SCL33 [Sesamum indicum] Length = 263 Score = 57.0 bits (136), Expect = 1e-06 Identities = 28/41 (68%), Positives = 35/41 (85%) Frame = +1 Query: 145 YSRSVSPVEKRYSRERSYSGSPVRDRSPSHDGAPRSPSRSP 267 YSRS+SP EKRYSRERS S +P+R+RSP++DG PR+ S SP Sbjct: 173 YSRSISPREKRYSRERSLSHTPLRERSPAYDG-PRNHSGSP 212 >ref|XP_011089730.1| serine/arginine-rich SC35-like splicing factor SCL30A [Sesamum indicum] Length = 265 Score = 57.0 bits (136), Expect = 1e-06 Identities = 29/41 (70%), Positives = 33/41 (80%) Frame = +1 Query: 145 YSRSVSPVEKRYSRERSYSGSPVRDRSPSHDGAPRSPSRSP 267 YSRSVSP +KRYSRERSYS SP RD SP ++G PR+ S SP Sbjct: 173 YSRSVSPRDKRYSRERSYSRSPARDHSPPYNG-PRNHSGSP 212 >gb|KZM86681.1| hypothetical protein DCAR_023815 [Daucus carota subsp. sativus] Length = 200 Score = 56.2 bits (134), Expect = 1e-06 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +1 Query: 145 YSRSVSPVEKRYSRERSYSGSPVRDRSPSHDGA 243 YSRSVSP EKRYSRERSYS SPVR+RSP ++G+ Sbjct: 116 YSRSVSPEEKRYSRERSYSRSPVRERSPPYNGS 148 >ref|XP_017219214.1| PREDICTED: serine/arginine-rich SC35-like splicing factor SCL33 isoform X2 [Daucus carota subsp. sativus] Length = 214 Score = 56.2 bits (134), Expect = 1e-06 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +1 Query: 145 YSRSVSPVEKRYSRERSYSGSPVRDRSPSHDGA 243 YSRSVSP EKRYSRERSYS SPVR+RSP ++G+ Sbjct: 130 YSRSVSPEEKRYSRERSYSRSPVRERSPPYNGS 162 >ref|XP_017219213.1| PREDICTED: serine/arginine-rich SC35-like splicing factor SCL30A isoform X1 [Daucus carota subsp. sativus] Length = 254 Score = 56.2 bits (134), Expect = 2e-06 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +1 Query: 145 YSRSVSPVEKRYSRERSYSGSPVRDRSPSHDGA 243 YSRSVSP EKRYSRERSYS SPVR+RSP ++G+ Sbjct: 170 YSRSVSPEEKRYSRERSYSRSPVRERSPPYNGS 202 >ref|XP_016472659.1| PREDICTED: serine/arginine-rich SC35-like splicing factor SCL33 [Nicotiana tabacum] Length = 263 Score = 56.2 bits (134), Expect = 2e-06 Identities = 29/41 (70%), Positives = 34/41 (82%) Frame = +1 Query: 145 YSRSVSPVEKRYSRERSYSGSPVRDRSPSHDGAPRSPSRSP 267 YSRSVSP EKRYSRERSYS SP RD SP ++G+ RS S++P Sbjct: 169 YSRSVSPEEKRYSRERSYSRSPARDISPPYNGS-RSRSQTP 208