BLASTX nr result
ID: Chrysanthemum22_contig00018990
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00018990 (365 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022009393.1| ricin B-like lectin R40G3 [Helianthus annuus] 104 5e-25 gb|OTF97743.1| putative hydroxyproline-rich glycoprotein family ... 104 1e-24 gb|KVI08421.1| Ricin B lectin domain-containing protein [Cynara ... 92 5e-20 ref|XP_022000576.1| ricin B-like lectin R40G3 [Helianthus annuus] 89 1e-19 ref|XP_023768968.1| ricin B-like lectin R40G3 [Lactuca sativa] 91 1e-19 ref|XP_022000577.1| ricin B-like lectin R40G3 [Helianthus annuus] 89 2e-19 gb|OTG01036.1| putative ricin B, lectin domain-containing protei... 89 2e-19 gb|PLY81558.1| hypothetical protein LSAT_2X58781 [Lactuca sativa] 91 3e-19 gb|OTG01037.1| putative ricin B, lectin domain-containing protei... 89 4e-19 gb|KVH90702.1| hypothetical protein Ccrd_007332 [Cynara carduncu... 86 3e-18 ref|XP_023756824.1| ricin B-like lectin EULS3 [Lactuca sativa] 84 1e-17 gb|PLY90584.1| hypothetical protein LSAT_6X38201 [Lactuca sativa] 84 1e-17 ref|XP_023756821.1| ricin B-like lectin R40G3 [Lactuca sativa] 83 8e-17 gb|PLY90575.1| hypothetical protein LSAT_6X38161 [Lactuca sativa] 83 9e-17 ref|XP_023756822.1| ricin B-like lectin R40G3 [Lactuca sativa] 80 1e-16 gb|PLY90679.1| hypothetical protein LSAT_6X38181 [Lactuca sativa] 80 1e-16 ref|XP_023768943.1| ricin B-like lectin EULS3 [Lactuca sativa] 78 1e-14 gb|PLY81561.1| hypothetical protein LSAT_2X58821 [Lactuca sativa] 78 1e-14 ref|XP_021310045.1| ricin B-like lectin R40G3 [Sorghum bicolor] ... 76 2e-14 gb|KZV28883.1| hypothetical protein F511_13678 [Dorcoceras hygro... 77 3e-14 >ref|XP_022009393.1| ricin B-like lectin R40G3 [Helianthus annuus] Length = 251 Score = 104 bits (259), Expect = 5e-25 Identities = 44/49 (89%), Positives = 49/49 (100%) Frame = -1 Query: 149 YTDDKPTVRVYCKAKTDYAMTIRDGQVVLAPSNPSDPHQHWIKDLKFST 3 YTD+KPTVR+YCKAKTDYA+TIRDGQV+LAPSNPSDPHQHW+KDLKFST Sbjct: 96 YTDNKPTVRIYCKAKTDYALTIRDGQVILAPSNPSDPHQHWVKDLKFST 144 >gb|OTF97743.1| putative hydroxyproline-rich glycoprotein family protein [Helianthus annuus] Length = 285 Score = 104 bits (259), Expect = 1e-24 Identities = 44/49 (89%), Positives = 49/49 (100%) Frame = -1 Query: 149 YTDDKPTVRVYCKAKTDYAMTIRDGQVVLAPSNPSDPHQHWIKDLKFST 3 YTD+KPTVR+YCKAKTDYA+TIRDGQV+LAPSNPSDPHQHW+KDLKFST Sbjct: 96 YTDNKPTVRIYCKAKTDYALTIRDGQVILAPSNPSDPHQHWVKDLKFST 144 >gb|KVI08421.1| Ricin B lectin domain-containing protein [Cynara cardunculus var. scolymus] Length = 258 Score = 91.7 bits (226), Expect = 5e-20 Identities = 39/49 (79%), Positives = 47/49 (95%) Frame = -1 Query: 149 YTDDKPTVRVYCKAKTDYAMTIRDGQVVLAPSNPSDPHQHWIKDLKFST 3 YTD+KPTVRVY KAK+DY++TIR+G+V+LAPSNPSDPHQHWIKD K+ST Sbjct: 103 YTDNKPTVRVYSKAKSDYSLTIREGKVILAPSNPSDPHQHWIKDEKYST 151 >ref|XP_022000576.1| ricin B-like lectin R40G3 [Helianthus annuus] Length = 205 Score = 89.4 bits (220), Expect = 1e-19 Identities = 38/49 (77%), Positives = 46/49 (93%) Frame = -1 Query: 149 YTDDKPTVRVYCKAKTDYAMTIRDGQVVLAPSNPSDPHQHWIKDLKFST 3 YTD+KPTVR YCKAK+DY++TIRDG+VVLAP+NPSD HQHWIK+ K+ST Sbjct: 50 YTDNKPTVRFYCKAKSDYSLTIRDGKVVLAPTNPSDHHQHWIKEEKYST 98 >ref|XP_023768968.1| ricin B-like lectin R40G3 [Lactuca sativa] Length = 259 Score = 90.5 bits (223), Expect = 1e-19 Identities = 37/49 (75%), Positives = 47/49 (95%) Frame = -1 Query: 149 YTDDKPTVRVYCKAKTDYAMTIRDGQVVLAPSNPSDPHQHWIKDLKFST 3 YTD+KPTVRVY KA+ D+++TIR+G+V+LAPSNPSDPHQHW+KDLK+ST Sbjct: 104 YTDNKPTVRVYTKARPDFSLTIREGKVILAPSNPSDPHQHWVKDLKYST 152 >ref|XP_022000577.1| ricin B-like lectin R40G3 [Helianthus annuus] Length = 190 Score = 88.6 bits (218), Expect = 2e-19 Identities = 38/49 (77%), Positives = 45/49 (91%) Frame = -1 Query: 149 YTDDKPTVRVYCKAKTDYAMTIRDGQVVLAPSNPSDPHQHWIKDLKFST 3 YTD+KPTVR YCKAK DY++TIRDG+VVLAP+NPSD HQHWIK+ K+ST Sbjct: 35 YTDNKPTVRFYCKAKPDYSLTIRDGKVVLAPTNPSDHHQHWIKEEKYST 83 >gb|OTG01036.1| putative ricin B, lectin domain-containing protein [Helianthus annuus] Length = 236 Score = 89.4 bits (220), Expect = 2e-19 Identities = 38/49 (77%), Positives = 46/49 (93%) Frame = -1 Query: 149 YTDDKPTVRVYCKAKTDYAMTIRDGQVVLAPSNPSDPHQHWIKDLKFST 3 YTD+KPTVR YCKAK+DY++TIRDG+VVLAP+NPSD HQHWIK+ K+ST Sbjct: 50 YTDNKPTVRFYCKAKSDYSLTIRDGKVVLAPTNPSDHHQHWIKEEKYST 98 >gb|PLY81558.1| hypothetical protein LSAT_2X58781 [Lactuca sativa] Length = 302 Score = 90.5 bits (223), Expect = 3e-19 Identities = 37/49 (75%), Positives = 47/49 (95%) Frame = -1 Query: 149 YTDDKPTVRVYCKAKTDYAMTIRDGQVVLAPSNPSDPHQHWIKDLKFST 3 YTD+KPTVRVY KA+ D+++TIR+G+V+LAPSNPSDPHQHW+KDLK+ST Sbjct: 104 YTDNKPTVRVYTKARPDFSLTIREGKVILAPSNPSDPHQHWVKDLKYST 152 >gb|OTG01037.1| putative ricin B, lectin domain-containing protein [Helianthus annuus] Length = 221 Score = 88.6 bits (218), Expect = 4e-19 Identities = 38/49 (77%), Positives = 45/49 (91%) Frame = -1 Query: 149 YTDDKPTVRVYCKAKTDYAMTIRDGQVVLAPSNPSDPHQHWIKDLKFST 3 YTD+KPTVR YCKAK DY++TIRDG+VVLAP+NPSD HQHWIK+ K+ST Sbjct: 35 YTDNKPTVRFYCKAKPDYSLTIRDGKVVLAPTNPSDHHQHWIKEEKYST 83 >gb|KVH90702.1| hypothetical protein Ccrd_007332 [Cynara cardunculus var. scolymus] Length = 191 Score = 85.5 bits (210), Expect = 3e-18 Identities = 37/49 (75%), Positives = 44/49 (89%) Frame = -1 Query: 149 YTDDKPTVRVYCKAKTDYAMTIRDGQVVLAPSNPSDPHQHWIKDLKFST 3 YTD+KPTVR Y KAK DY++TIRDG+V+LAP+NPSD HQHWIK+ KFST Sbjct: 51 YTDNKPTVRFYSKAKPDYSLTIRDGKVILAPTNPSDHHQHWIKEEKFST 99 >ref|XP_023756824.1| ricin B-like lectin EULS3 [Lactuca sativa] Length = 202 Score = 84.3 bits (207), Expect = 1e-17 Identities = 36/49 (73%), Positives = 43/49 (87%) Frame = -1 Query: 149 YTDDKPTVRVYCKAKTDYAMTIRDGQVVLAPSNPSDPHQHWIKDLKFST 3 YTD+KPTVR Y K KTDY++TIR+G+ VLAP+NPSDPHQHWIK+ K ST Sbjct: 50 YTDNKPTVRFYSKIKTDYSLTIRNGEAVLAPTNPSDPHQHWIKEEKLST 98 >gb|PLY90584.1| hypothetical protein LSAT_6X38201 [Lactuca sativa] Length = 212 Score = 84.3 bits (207), Expect = 1e-17 Identities = 36/49 (73%), Positives = 43/49 (87%) Frame = -1 Query: 149 YTDDKPTVRVYCKAKTDYAMTIRDGQVVLAPSNPSDPHQHWIKDLKFST 3 YTD+KPTVR Y K KTDY++TIR+G+ VLAP+NPSDPHQHWIK+ K ST Sbjct: 50 YTDNKPTVRFYSKIKTDYSLTIRNGEAVLAPTNPSDPHQHWIKEEKLST 98 >ref|XP_023756821.1| ricin B-like lectin R40G3 [Lactuca sativa] Length = 238 Score = 82.8 bits (203), Expect = 8e-17 Identities = 36/49 (73%), Positives = 44/49 (89%) Frame = -1 Query: 149 YTDDKPTVRVYCKAKTDYAMTIRDGQVVLAPSNPSDPHQHWIKDLKFST 3 YTD+KPTVR Y K KT+Y++TIR+G+VVLAP+NPSD HQHWIK+ KFST Sbjct: 86 YTDNKPTVRFYSKIKTNYSLTIRNGEVVLAPTNPSDHHQHWIKEEKFST 134 >gb|PLY90575.1| hypothetical protein LSAT_6X38161 [Lactuca sativa] Length = 246 Score = 82.8 bits (203), Expect = 9e-17 Identities = 36/49 (73%), Positives = 44/49 (89%) Frame = -1 Query: 149 YTDDKPTVRVYCKAKTDYAMTIRDGQVVLAPSNPSDPHQHWIKDLKFST 3 YTD+KPTVR Y K KT+Y++TIR+G+VVLAP+NPSD HQHWIK+ KFST Sbjct: 86 YTDNKPTVRFYSKIKTNYSLTIRNGEVVLAPTNPSDHHQHWIKEEKFST 134 >ref|XP_023756822.1| ricin B-like lectin R40G3 [Lactuca sativa] Length = 160 Score = 80.5 bits (197), Expect = 1e-16 Identities = 36/49 (73%), Positives = 41/49 (83%) Frame = -1 Query: 149 YTDDKPTVRVYCKAKTDYAMTIRDGQVVLAPSNPSDPHQHWIKDLKFST 3 YTD+KPTVR Y K KTDY++TIRDG V+AP+N SD HQHWIKD KFST Sbjct: 7 YTDNKPTVRFYTKIKTDYSLTIRDGAPVIAPTNSSDLHQHWIKDEKFST 55 >gb|PLY90679.1| hypothetical protein LSAT_6X38181 [Lactuca sativa] Length = 166 Score = 80.5 bits (197), Expect = 1e-16 Identities = 36/49 (73%), Positives = 41/49 (83%) Frame = -1 Query: 149 YTDDKPTVRVYCKAKTDYAMTIRDGQVVLAPSNPSDPHQHWIKDLKFST 3 YTD+KPTVR Y K KTDY++TIRDG V+AP+N SD HQHWIKD KFST Sbjct: 7 YTDNKPTVRFYTKIKTDYSLTIRDGAPVIAPTNSSDLHQHWIKDEKFST 55 >ref|XP_023768943.1| ricin B-like lectin EULS3 [Lactuca sativa] Length = 306 Score = 78.2 bits (191), Expect = 1e-14 Identities = 34/47 (72%), Positives = 41/47 (87%) Frame = -1 Query: 149 YTDDKPTVRVYCKAKTDYAMTIRDGQVVLAPSNPSDPHQHWIKDLKF 9 Y D+KPT RVY KAKTDY++TIR+G+V+LAP+N SD HQHWIKD KF Sbjct: 151 YMDNKPTFRVYTKAKTDYSLTIRNGKVILAPTNSSDLHQHWIKDEKF 197 >gb|PLY81561.1| hypothetical protein LSAT_2X58821 [Lactuca sativa] Length = 324 Score = 78.2 bits (191), Expect = 1e-14 Identities = 34/47 (72%), Positives = 41/47 (87%) Frame = -1 Query: 149 YTDDKPTVRVYCKAKTDYAMTIRDGQVVLAPSNPSDPHQHWIKDLKF 9 Y D+KPT RVY KAKTDY++TIR+G+V+LAP+N SD HQHWIKD KF Sbjct: 151 YMDNKPTFRVYTKAKTDYSLTIRNGKVILAPTNSSDLHQHWIKDEKF 197 >ref|XP_021310045.1| ricin B-like lectin R40G3 [Sorghum bicolor] gb|KXG36971.1| hypothetical protein SORBI_3002G421300 [Sorghum bicolor] Length = 196 Score = 75.9 bits (185), Expect = 2e-14 Identities = 31/45 (68%), Positives = 41/45 (91%) Frame = -1 Query: 137 KPTVRVYCKAKTDYAMTIRDGQVVLAPSNPSDPHQHWIKDLKFST 3 +PTV+VYC+A +YAMTIRDG+VVLAP+NP D +QHWIKD+++ST Sbjct: 44 QPTVKVYCRANPNYAMTIRDGRVVLAPANPKDEYQHWIKDMRWST 88 >gb|KZV28883.1| hypothetical protein F511_13678 [Dorcoceras hygrometricum] Length = 271 Score = 76.6 bits (187), Expect = 3e-14 Identities = 32/45 (71%), Positives = 43/45 (95%) Frame = -1 Query: 137 KPTVRVYCKAKTDYAMTIRDGQVVLAPSNPSDPHQHWIKDLKFST 3 +PTV+VY KA++++++TIRDGQVVLAPS+PSDPHQHWIK+ K+ST Sbjct: 118 EPTVKVYSKAESNFSLTIRDGQVVLAPSDPSDPHQHWIKEEKYST 162