BLASTX nr result
ID: Chrysanthemum22_contig00018754
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00018754 (441 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022005492.1| metal transporter Nramp3-like [Helianthus an... 57 2e-06 gb|KVI08941.1| Natural resistance-associated macrophage protein,... 57 2e-06 ref|XP_023754328.1| metal transporter Nramp3-like [Lactuca sativ... 55 9e-06 >ref|XP_022005492.1| metal transporter Nramp3-like [Helianthus annuus] gb|OTF98798.1| putative natural resistance-associated macrophage protein 3 [Helianthus annuus] Length = 507 Score = 56.6 bits (135), Expect = 2e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -1 Query: 441 FALIPLLCLVAKDDLMGVFKIGPVLKDVKY 352 FALIPLLCLVAKDDLMGVFKIGPVLK + + Sbjct: 413 FALIPLLCLVAKDDLMGVFKIGPVLKTISW 442 >gb|KVI08941.1| Natural resistance-associated macrophage protein, partial [Cynara cardunculus var. scolymus] Length = 551 Score = 56.6 bits (135), Expect = 2e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -1 Query: 441 FALIPLLCLVAKDDLMGVFKIGPVLKDVKY 352 FALIPLLCLVAKDDLMGVFKIGPVLK + + Sbjct: 457 FALIPLLCLVAKDDLMGVFKIGPVLKTISW 486 >ref|XP_023754328.1| metal transporter Nramp3-like [Lactuca sativa] gb|PLY92654.1| hypothetical protein LSAT_2X84661 [Lactuca sativa] Length = 507 Score = 54.7 bits (130), Expect = 9e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -1 Query: 441 FALIPLLCLVAKDDLMGVFKIGPVLKDVKY 352 FALIPLLCLVAKDDLMGVFKIGP LK + + Sbjct: 413 FALIPLLCLVAKDDLMGVFKIGPFLKTISW 442