BLASTX nr result
ID: Chrysanthemum22_contig00018744
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00018744 (445 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022025647.1| receptor protein-tyrosine kinase CEPR2 [Heli... 58 8e-07 ref|XP_023744749.1| receptor protein-tyrosine kinase CEPR2 [Lact... 56 4e-06 gb|KVH95549.1| Leucine-rich repeat-containing protein [Cynara ca... 55 5e-06 >ref|XP_022025647.1| receptor protein-tyrosine kinase CEPR2 [Helianthus annuus] gb|OTF86331.1| putative leucine-rich receptor-like protein kinase family protein [Helianthus annuus] Length = 996 Score = 57.8 bits (138), Expect = 8e-07 Identities = 28/62 (45%), Positives = 38/62 (61%), Gaps = 4/62 (6%) Frame = -3 Query: 176 MSKSAVLVFCIFVFSLPGLCW----SASPRDEVKALLELKKEFEDPFNYLDSWKVADSPC 9 ++ S+ + IF+ SL G+ + +S EV ALL+ K FEDP NYL SWK+ DSPC Sbjct: 15 LTPSSRQITIIFIISLAGIFFRPASGSSSNPEVNALLDFKNHFEDPLNYLKSWKITDSPC 74 Query: 8 GF 3 F Sbjct: 75 QF 76 >ref|XP_023744749.1| receptor protein-tyrosine kinase CEPR2 [Lactuca sativa] gb|PLY65517.1| hypothetical protein LSAT_3X800 [Lactuca sativa] Length = 998 Score = 55.8 bits (133), Expect = 4e-06 Identities = 33/68 (48%), Positives = 42/68 (61%), Gaps = 6/68 (8%) Frame = -3 Query: 188 LFSKMSKSAVLVFCIFVFSL------PGLCWSASPRDEVKALLELKKEFEDPFNYLDSWK 27 L S ++VL+F +FVFS P C S S EV ALL+ KK+ +DP NYLDSWK Sbjct: 7 LRSSRQITSVLLF-LFVFSFACIFFRPVFCSSLSV--EVHALLDFKKQLKDPLNYLDSWK 63 Query: 26 VADSPCGF 3 + +SPC F Sbjct: 64 ITESPCQF 71 >gb|KVH95549.1| Leucine-rich repeat-containing protein [Cynara cardunculus var. scolymus] Length = 993 Score = 55.5 bits (132), Expect = 5e-06 Identities = 30/62 (48%), Positives = 39/62 (62%), Gaps = 2/62 (3%) Frame = -3 Query: 182 SKMSKSAVLVFCIFV--FSLPGLCWSASPRDEVKALLELKKEFEDPFNYLDSWKVADSPC 9 S+ + F FV F P LC S++ EV+ALL+ KK+ +DPF+YLDSWK A SPC Sbjct: 13 SRQITTVSFFFLSFVGFFFRPTLCSSSAA--EVRALLDFKKQLKDPFHYLDSWKTAGSPC 70 Query: 8 GF 3 F Sbjct: 71 RF 72