BLASTX nr result
ID: Chrysanthemum22_contig00018717
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00018717 (1084 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_018817155.1| PREDICTED: BTB/POZ domain-containing protein... 61 1e-06 gb|PLY80626.1| hypothetical protein LSAT_4X135241 [Lactuca sativa] 60 2e-06 ref|XP_023770115.1| BTB/POZ domain-containing protein At1g21780 ... 60 2e-06 ref|XP_021992716.1| BTB/POZ domain-containing protein At1g21780 ... 59 4e-06 ref|XP_021647389.1| BTB/POZ domain-containing protein At1g21780-... 59 5e-06 >ref|XP_018817155.1| PREDICTED: BTB/POZ domain-containing protein At1g21780-like [Juglans regia] Length = 326 Score = 60.8 bits (146), Expect = 1e-06 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = +2 Query: 674 LHERLLWTIQDFVSPVDPTFHGRFIIDVEFLNLQV 778 +HERLL T +DFV PVDPTFHGRFIIDVEFL+L++ Sbjct: 87 IHERLLRTCEDFVWPVDPTFHGRFIIDVEFLDLKI 121 >gb|PLY80626.1| hypothetical protein LSAT_4X135241 [Lactuca sativa] Length = 326 Score = 60.1 bits (144), Expect = 2e-06 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = +2 Query: 674 LHERLLWTIQDFVSPVDPTFHGRFIIDVEFLNLQVW 781 +HERLL T +DFV PVD TFHGRFIIDVEFL+LQV+ Sbjct: 87 IHERLLRTSEDFVWPVDSTFHGRFIIDVEFLDLQVY 122 >ref|XP_023770115.1| BTB/POZ domain-containing protein At1g21780 [Lactuca sativa] Length = 334 Score = 60.1 bits (144), Expect = 2e-06 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = +2 Query: 674 LHERLLWTIQDFVSPVDPTFHGRFIIDVEFLNLQVW 781 +HERLL T +DFV PVD TFHGRFIIDVEFL+LQV+ Sbjct: 95 IHERLLRTSEDFVWPVDSTFHGRFIIDVEFLDLQVY 130 >ref|XP_021992716.1| BTB/POZ domain-containing protein At1g21780 [Helianthus annuus] gb|OTG07050.1| putative BTB/POZ domain-containing protein [Helianthus annuus] Length = 326 Score = 59.3 bits (142), Expect = 4e-06 Identities = 26/36 (72%), Positives = 32/36 (88%) Frame = +2 Query: 674 LHERLLWTIQDFVSPVDPTFHGRFIIDVEFLNLQVW 781 +HERLL T +DFV PVD TFHGRF+IDVEFL+LQ++ Sbjct: 87 IHERLLRTSEDFVWPVDSTFHGRFVIDVEFLDLQIY 122 >ref|XP_021647389.1| BTB/POZ domain-containing protein At1g21780-like [Hevea brasiliensis] Length = 335 Score = 58.9 bits (141), Expect = 5e-06 Identities = 27/42 (64%), Positives = 31/42 (73%) Frame = +2 Query: 674 LHERLLWTIQDFVSPVDPTFHGRFIIDVEFLNLQVWQTKKAG 799 +HERLL T DFV PVD TFH RFIIDVEFL+L++W G Sbjct: 87 VHERLLRTSDDFVWPVDSTFHDRFIIDVEFLDLKIWHLLNGG 128