BLASTX nr result
ID: Chrysanthemum22_contig00018354
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00018354 (376 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PPD77978.1| hypothetical protein GOBAR_DD25090 [Gossypium bar... 69 6e-12 ref|XP_020273935.1| UDP-glucuronic acid decarboxylase 4-like [As... 69 7e-12 gb|KJB23283.1| hypothetical protein B456_004G090000 [Gossypium r... 71 8e-12 dbj|GAU43758.1| hypothetical protein TSUD_36520 [Trifolium subte... 66 1e-11 gb|PNT50782.1| hypothetical protein POPTR_002G204400v3 [Populus ... 70 2e-11 gb|PON80377.1| Nucleotide sugar epimerase [Parasponia andersonii] 67 2e-11 gb|KZN10177.1| hypothetical protein DCAR_002833 [Daucus carota s... 69 2e-11 emb|CDP17130.1| unnamed protein product [Coffea canephora] 69 2e-11 gb|OWM71231.1| hypothetical protein CDL15_Pgr011358 [Punica gran... 69 2e-11 gb|OTG06250.1| putative NAD(P)-binding domain-containing protein... 69 2e-11 gb|PKI73009.1| hypothetical protein CRG98_006612 [Punica granatum] 67 2e-11 dbj|GAY40951.1| hypothetical protein CUMW_055730 [Citrus unshiu] 70 2e-11 gb|KHG20553.1| UDP-glucuronic acid decarboxylase 1 [Gossypium ar... 67 3e-11 gb|KHN02958.1| UDP-glucuronic acid decarboxylase 1 [Glycine soja] 69 3e-11 gb|KHN03354.1| UDP-glucuronic acid decarboxylase 1 [Glycine soja] 69 3e-11 gb|PNT04534.1| hypothetical protein POPTR_014G129200v3 [Populus ... 69 4e-11 gb|KRH69291.1| hypothetical protein GLYMA_02G0180002, partial [G... 65 5e-11 gb|OTG21736.1| putative NAD(P)-binding domain-containing protein... 69 5e-11 ref|XP_003550538.1| PREDICTED: UDP-glucuronic acid decarboxylase... 69 6e-11 ref|XP_011011221.1| PREDICTED: UDP-glucuronic acid decarboxylase... 69 6e-11 >gb|PPD77978.1| hypothetical protein GOBAR_DD25090 [Gossypium barbadense] Length = 201 Score = 69.3 bits (168), Expect = 6e-12 Identities = 30/36 (83%), Positives = 35/36 (97%) Frame = +3 Query: 207 AAKMVEGLMRLMEGEHVGPFNLGNPGEFTMLELAQL 314 + K+VEGLMRLMEGEH+GPFNLGNPGEFTMLELA++ Sbjct: 92 SGKLVEGLMRLMEGEHIGPFNLGNPGEFTMLELAEV 127 >ref|XP_020273935.1| UDP-glucuronic acid decarboxylase 4-like [Asparagus officinalis] gb|ONK62923.1| uncharacterized protein A4U43_C07F9520 [Asparagus officinalis] Length = 166 Score = 68.6 bits (166), Expect = 7e-12 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = +3 Query: 216 MVEGLMRLMEGEHVGPFNLGNPGEFTMLELAQL 314 +VEGLMRLMEGEHVGPFNLGNPGEFTMLELAQ+ Sbjct: 63 LVEGLMRLMEGEHVGPFNLGNPGEFTMLELAQV 95 >gb|KJB23283.1| hypothetical protein B456_004G090000 [Gossypium raimondii] Length = 378 Score = 70.9 bits (172), Expect = 8e-12 Identities = 30/37 (81%), Positives = 36/37 (97%) Frame = +3 Query: 216 MVEGLMRLMEGEHVGPFNLGNPGEFTMLELAQLTAYF 326 +VEGLMRLMEGEH+GPFNLGNPGEFTMLELA+++ Y+ Sbjct: 335 LVEGLMRLMEGEHIGPFNLGNPGEFTMLELAEVSIYY 371 >dbj|GAU43758.1| hypothetical protein TSUD_36520 [Trifolium subterraneum] Length = 104 Score = 66.2 bits (160), Expect = 1e-11 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = +3 Query: 219 VEGLMRLMEGEHVGPFNLGNPGEFTMLELAQL 314 VEGLMRLMEGEHVGPFNLGNPGEFTMLELA++ Sbjct: 4 VEGLMRLMEGEHVGPFNLGNPGEFTMLELAKV 35 >gb|PNT50782.1| hypothetical protein POPTR_002G204400v3 [Populus trichocarpa] Length = 386 Score = 70.1 bits (170), Expect = 2e-11 Identities = 31/36 (86%), Positives = 35/36 (97%) Frame = +3 Query: 216 MVEGLMRLMEGEHVGPFNLGNPGEFTMLELAQLTAY 323 +VEGLMRLMEGEHVGPFNLGNPGEFTMLELAQ++ + Sbjct: 337 LVEGLMRLMEGEHVGPFNLGNPGEFTMLELAQVSVF 372 >gb|PON80377.1| Nucleotide sugar epimerase [Parasponia andersonii] Length = 161 Score = 67.4 bits (163), Expect = 2e-11 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = +3 Query: 216 MVEGLMRLMEGEHVGPFNLGNPGEFTMLELAQL 314 +VEGLMRLMEG+HVGPFNLGNPGEFTMLELAQ+ Sbjct: 55 LVEGLMRLMEGDHVGPFNLGNPGEFTMLELAQV 87 >gb|KZN10177.1| hypothetical protein DCAR_002833 [Daucus carota subsp. sativus] Length = 222 Score = 68.6 bits (166), Expect = 2e-11 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = +3 Query: 216 MVEGLMRLMEGEHVGPFNLGNPGEFTMLELAQL 314 +VEGLMRLMEGEHVGPFNLGNPGEFTMLELAQ+ Sbjct: 120 LVEGLMRLMEGEHVGPFNLGNPGEFTMLELAQV 152 >emb|CDP17130.1| unnamed protein product [Coffea canephora] Length = 222 Score = 68.6 bits (166), Expect = 2e-11 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = +3 Query: 216 MVEGLMRLMEGEHVGPFNLGNPGEFTMLELAQL 314 +VEGLMRLMEGEHVGPFNLGNPGEFTMLELAQ+ Sbjct: 120 LVEGLMRLMEGEHVGPFNLGNPGEFTMLELAQV 152 >gb|OWM71231.1| hypothetical protein CDL15_Pgr011358 [Punica granatum] Length = 225 Score = 68.6 bits (166), Expect = 2e-11 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = +3 Query: 216 MVEGLMRLMEGEHVGPFNLGNPGEFTMLELAQL 314 +VEGLMRLMEGEHVGPFNLGNPGEFTMLELAQ+ Sbjct: 120 LVEGLMRLMEGEHVGPFNLGNPGEFTMLELAQV 152 >gb|OTG06250.1| putative NAD(P)-binding domain-containing protein [Helianthus annuus] Length = 226 Score = 68.6 bits (166), Expect = 2e-11 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = +3 Query: 216 MVEGLMRLMEGEHVGPFNLGNPGEFTMLELAQL 314 +VEGLMRLMEGEHVGPFNLGNPGEFTMLELAQ+ Sbjct: 120 LVEGLMRLMEGEHVGPFNLGNPGEFTMLELAQV 152 >gb|PKI73009.1| hypothetical protein CRG98_006612 [Punica granatum] Length = 168 Score = 67.4 bits (163), Expect = 2e-11 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = +3 Query: 216 MVEGLMRLMEGEHVGPFNLGNPGEFTMLELAQL 314 +VEGLMRLMEGEHVGPFNLGNPGEFTMLELA++ Sbjct: 63 LVEGLMRLMEGEHVGPFNLGNPGEFTMLELAEV 95 >dbj|GAY40951.1| hypothetical protein CUMW_055730 [Citrus unshiu] Length = 499 Score = 69.7 bits (169), Expect = 2e-11 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = +3 Query: 216 MVEGLMRLMEGEHVGPFNLGNPGEFTMLELAQL 314 +VEGLMRLMEGEHVGPFNLGNPGEFTMLELAQL Sbjct: 381 LVEGLMRLMEGEHVGPFNLGNPGEFTMLELAQL 413 >gb|KHG20553.1| UDP-glucuronic acid decarboxylase 1 [Gossypium arboreum] Length = 190 Score = 67.4 bits (163), Expect = 3e-11 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = +3 Query: 216 MVEGLMRLMEGEHVGPFNLGNPGEFTMLELAQL 314 +VEGLMRLMEGEHVGPFNLGNPGEFTMLELA++ Sbjct: 83 LVEGLMRLMEGEHVGPFNLGNPGEFTMLELAEV 115 >gb|KHN02958.1| UDP-glucuronic acid decarboxylase 1 [Glycine soja] Length = 274 Score = 68.6 bits (166), Expect = 3e-11 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = +3 Query: 216 MVEGLMRLMEGEHVGPFNLGNPGEFTMLELAQL 314 +VEGLMRLMEGEHVGPFNLGNPGEFTMLELAQ+ Sbjct: 168 LVEGLMRLMEGEHVGPFNLGNPGEFTMLELAQV 200 >gb|KHN03354.1| UDP-glucuronic acid decarboxylase 1 [Glycine soja] Length = 279 Score = 68.6 bits (166), Expect = 3e-11 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = +3 Query: 216 MVEGLMRLMEGEHVGPFNLGNPGEFTMLELAQL 314 +VEGLMRLMEGEHVGPFNLGNPGEFTMLELAQ+ Sbjct: 173 LVEGLMRLMEGEHVGPFNLGNPGEFTMLELAQV 205 >gb|PNT04534.1| hypothetical protein POPTR_014G129200v3 [Populus trichocarpa] Length = 441 Score = 68.9 bits (167), Expect = 4e-11 Identities = 31/34 (91%), Positives = 34/34 (100%) Frame = +3 Query: 216 MVEGLMRLMEGEHVGPFNLGNPGEFTMLELAQLT 317 +VEGLMRLMEGEHVGPFNLGNPGEFTMLELAQ++ Sbjct: 336 LVEGLMRLMEGEHVGPFNLGNPGEFTMLELAQVS 369 >gb|KRH69291.1| hypothetical protein GLYMA_02G0180002, partial [Glycine max] Length = 101 Score = 64.7 bits (156), Expect = 5e-11 Identities = 29/32 (90%), Positives = 32/32 (100%) Frame = +3 Query: 219 VEGLMRLMEGEHVGPFNLGNPGEFTMLELAQL 314 VEGL+RLMEGEHVGPFNLGNPGEFTMLELA++ Sbjct: 1 VEGLIRLMEGEHVGPFNLGNPGEFTMLELAKV 32 >gb|OTG21736.1| putative NAD(P)-binding domain-containing protein [Helianthus annuus] Length = 374 Score = 68.6 bits (166), Expect = 5e-11 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = +3 Query: 216 MVEGLMRLMEGEHVGPFNLGNPGEFTMLELAQL 314 +VEGLMRLMEGEHVGPFNLGNPGEFTMLELAQ+ Sbjct: 266 LVEGLMRLMEGEHVGPFNLGNPGEFTMLELAQV 298 >ref|XP_003550538.1| PREDICTED: UDP-glucuronic acid decarboxylase 2-like [Glycine max] gb|KRH02265.1| hypothetical protein GLYMA_17G027300 [Glycine max] Length = 395 Score = 68.6 bits (166), Expect = 6e-11 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = +3 Query: 216 MVEGLMRLMEGEHVGPFNLGNPGEFTMLELAQL 314 +VEGLMRLMEGEHVGPFNLGNPGEFTMLELAQ+ Sbjct: 289 LVEGLMRLMEGEHVGPFNLGNPGEFTMLELAQV 321 >ref|XP_011011221.1| PREDICTED: UDP-glucuronic acid decarboxylase 2-like isoform X3 [Populus euphratica] Length = 396 Score = 68.6 bits (166), Expect = 6e-11 Identities = 30/36 (83%), Positives = 35/36 (97%) Frame = +3 Query: 216 MVEGLMRLMEGEHVGPFNLGNPGEFTMLELAQLTAY 323 +VEGLMRLMEGEHVGPFNLGNPGEFTMLELA+++ + Sbjct: 337 LVEGLMRLMEGEHVGPFNLGNPGEFTMLELAKVSVF 372