BLASTX nr result
ID: Chrysanthemum22_contig00018339
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00018339 (608 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022009393.1| ricin B-like lectin R40G3 [Helianthus annuus] 63 2e-08 gb|OTF97743.1| putative hydroxyproline-rich glycoprotein family ... 63 3e-08 gb|KVI08421.1| Ricin B lectin domain-containing protein [Cynara ... 57 4e-06 >ref|XP_022009393.1| ricin B-like lectin R40G3 [Helianthus annuus] Length = 251 Score = 62.8 bits (151), Expect = 2e-08 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = -3 Query: 414 YTDGKPTIRVRCMAKLGYALTIRAGQVLLASSNPSDPYQ 298 YTD KPT+R+ C AK YALTIR GQV+LA SNPSDP+Q Sbjct: 96 YTDNKPTVRIYCKAKTDYALTIRDGQVILAPSNPSDPHQ 134 >gb|OTF97743.1| putative hydroxyproline-rich glycoprotein family protein [Helianthus annuus] Length = 285 Score = 62.8 bits (151), Expect = 3e-08 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = -3 Query: 414 YTDGKPTIRVRCMAKLGYALTIRAGQVLLASSNPSDPYQ 298 YTD KPT+R+ C AK YALTIR GQV+LA SNPSDP+Q Sbjct: 96 YTDNKPTVRIYCKAKTDYALTIRDGQVILAPSNPSDPHQ 134 >gb|KVI08421.1| Ricin B lectin domain-containing protein [Cynara cardunculus var. scolymus] Length = 258 Score = 56.6 bits (135), Expect = 4e-06 Identities = 26/39 (66%), Positives = 31/39 (79%) Frame = -3 Query: 414 YTDGKPTIRVRCMAKLGYALTIRAGQVLLASSNPSDPYQ 298 YTD KPT+RV AK Y+LTIR G+V+LA SNPSDP+Q Sbjct: 103 YTDNKPTVRVYSKAKSDYSLTIREGKVILAPSNPSDPHQ 141