BLASTX nr result
ID: Chrysanthemum22_contig00018239
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00018239 (476 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010091342.1| oxysterol-binding protein-related protein 1C... 41 7e-06 ref|XP_024018139.1| oxysterol-binding protein-related protein 1C... 41 7e-06 >ref|XP_010091342.1| oxysterol-binding protein-related protein 1C isoform X1 [Morus notabilis] gb|EXB44332.1| Oxysterol-binding protein-related protein 1C [Morus notabilis] Length = 839 Score = 41.2 bits (95), Expect(2) = 7e-06 Identities = 19/36 (52%), Positives = 25/36 (69%) Frame = +2 Query: 293 KEKLPPIDSRLRPDQRCLENDE*QSLEKQQTFFDQK 400 KEKLPP DSRLRPDQR LE+ E + ++ +Q+ Sbjct: 746 KEKLPPTDSRLRPDQRYLESGEYEMANSEKLRLEQR 781 Score = 36.2 bits (82), Expect(2) = 7e-06 Identities = 15/22 (68%), Positives = 19/22 (86%) Frame = +3 Query: 231 FKSTSDSHLLWRKSKPIKVSTR 296 F+S S+SHLLW++SKP K STR Sbjct: 707 FESLSESHLLWKRSKPPKFSTR 728 >ref|XP_024018139.1| oxysterol-binding protein-related protein 1C isoform X2 [Morus notabilis] Length = 518 Score = 41.2 bits (95), Expect(2) = 7e-06 Identities = 19/36 (52%), Positives = 25/36 (69%) Frame = +2 Query: 293 KEKLPPIDSRLRPDQRCLENDE*QSLEKQQTFFDQK 400 KEKLPP DSRLRPDQR LE+ E + ++ +Q+ Sbjct: 425 KEKLPPTDSRLRPDQRYLESGEYEMANSEKLRLEQR 460 Score = 36.2 bits (82), Expect(2) = 7e-06 Identities = 15/22 (68%), Positives = 19/22 (86%) Frame = +3 Query: 231 FKSTSDSHLLWRKSKPIKVSTR 296 F+S S+SHLLW++SKP K STR Sbjct: 386 FESLSESHLLWKRSKPPKFSTR 407