BLASTX nr result
ID: Chrysanthemum22_contig00018117
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00018117 (383 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023745441.1| phosphatidylinositol/phosphatidylcholine tra... 70 1e-18 gb|KVI06539.1| Cellular retinaldehyde binding/alpha-tocopherol t... 66 2e-17 gb|PPR88768.1| hypothetical protein GOBAR_AA31913 [Gossypium bar... 73 6e-17 ref|XP_016749055.1| PREDICTED: phosphatidylinositol/phosphatidyl... 73 7e-17 gb|KHG28545.1| Bifunctional dihydrofolate reductase-thymidylate ... 73 8e-17 gb|OMO87538.1| hypothetical protein CCACVL1_08955 [Corchorus cap... 70 2e-16 gb|OMO75214.1| hypothetical protein COLO4_26256 [Corchorus olito... 70 2e-16 ref|XP_017981301.1| PREDICTED: phosphatidylinositol/phosphatidyl... 70 2e-16 gb|EOY14829.1| Sec14p-like phosphatidylinositol transfer family ... 70 2e-16 gb|EOY14831.1| Sec14p-like phosphatidylinositol transfer family ... 70 2e-16 ref|XP_016687592.1| PREDICTED: phosphatidylinositol/phosphatidyl... 71 2e-16 gb|KJB58224.1| hypothetical protein B456_009G199800 [Gossypium r... 71 3e-16 ref|XP_012444856.1| PREDICTED: phosphatidylinositol/phosphatidyl... 71 3e-16 gb|KJB58223.1| hypothetical protein B456_009G199800 [Gossypium r... 71 3e-16 ref|XP_012444857.1| PREDICTED: phosphatidylinositol/phosphatidyl... 71 3e-16 ref|XP_012444858.1| PREDICTED: phosphatidylinositol/phosphatidyl... 71 3e-16 gb|KJB58222.1| hypothetical protein B456_009G199800 [Gossypium r... 71 3e-16 ref|XP_012444860.1| PREDICTED: phosphatidylinositol/phosphatidyl... 71 3e-16 ref|XP_012071909.1| phosphatidylinositol/phosphatidylcholine tra... 73 4e-16 ref|XP_017607738.1| PREDICTED: phosphatidylinositol/phosphatidyl... 70 5e-16 >ref|XP_023745441.1| phosphatidylinositol/phosphatidylcholine transfer protein SFH6-like [Lactuca sativa] gb|PLY64993.1| hypothetical protein LSAT_4X117200 [Lactuca sativa] Length = 397 Score = 70.1 bits (170), Expect(2) = 1e-18 Identities = 30/39 (76%), Positives = 33/39 (84%) Frame = -1 Query: 383 RWRKDFGTDTIFEDFKFSELDKVLKYFCQSYHGTDKEGR 267 +WRKDFG D I EDFKFSELD+VL+YF Q YHG DKEGR Sbjct: 128 QWRKDFGADNILEDFKFSELDEVLRYFHQGYHGIDKEGR 166 Score = 50.8 bits (120), Expect(2) = 1e-18 Identities = 22/26 (84%), Positives = 25/26 (96%) Frame = -3 Query: 273 GTPIYIEILGQADPKKLMKVTTIERW 196 G P+YIEILGQADPKKLMKVTT+ER+ Sbjct: 165 GRPVYIEILGQADPKKLMKVTTVERY 190 >gb|KVI06539.1| Cellular retinaldehyde binding/alpha-tocopherol transport [Cynara cardunculus var. scolymus] Length = 368 Score = 66.2 bits (160), Expect(2) = 2e-17 Identities = 27/39 (69%), Positives = 33/39 (84%) Frame = -1 Query: 383 RWRKDFGTDTIFEDFKFSELDKVLKYFCQSYHGTDKEGR 267 +WRKDFG + I ED+KFSELD+VL+YF Q YHG DK+GR Sbjct: 152 QWRKDFGANNILEDYKFSELDEVLQYFLQGYHGIDKDGR 190 Score = 50.1 bits (118), Expect(2) = 2e-17 Identities = 22/26 (84%), Positives = 25/26 (96%) Frame = -3 Query: 273 GTPIYIEILGQADPKKLMKVTTIERW 196 G P+YIEILGQADPKKLM+VTTIER+ Sbjct: 189 GRPVYIEILGQADPKKLMRVTTIERY 214 >gb|PPR88768.1| hypothetical protein GOBAR_AA31913 [Gossypium barbadense] Length = 842 Score = 72.8 bits (177), Expect(2) = 6e-17 Identities = 31/39 (79%), Positives = 35/39 (89%) Frame = -1 Query: 383 RWRKDFGTDTIFEDFKFSELDKVLKYFCQSYHGTDKEGR 267 +WRKDFGTDTI EDF+FSELD+VLKY+ Q YHG DKEGR Sbjct: 130 QWRKDFGTDTILEDFEFSELDEVLKYYPQGYHGVDKEGR 168 Score = 42.0 bits (97), Expect(2) = 6e-17 Identities = 16/26 (61%), Positives = 23/26 (88%) Frame = -3 Query: 273 GTPIYIEILGQADPKKLMKVTTIERW 196 G P+YIE+LG+ +P KLM+VTT+ER+ Sbjct: 167 GRPVYIELLGKVEPDKLMRVTTVERY 192 >ref|XP_016749055.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer protein SFH8-like [Gossypium hirsutum] Length = 622 Score = 72.8 bits (177), Expect(2) = 7e-17 Identities = 31/39 (79%), Positives = 35/39 (89%) Frame = -1 Query: 383 RWRKDFGTDTIFEDFKFSELDKVLKYFCQSYHGTDKEGR 267 +WRKDFGTDTI EDF+FSELD+VLKY+ Q YHG DKEGR Sbjct: 131 QWRKDFGTDTILEDFEFSELDEVLKYYPQGYHGVDKEGR 169 Score = 42.0 bits (97), Expect(2) = 7e-17 Identities = 16/26 (61%), Positives = 23/26 (88%) Frame = -3 Query: 273 GTPIYIEILGQADPKKLMKVTTIERW 196 G P+YIE+LG+ +P KLM+VTT+ER+ Sbjct: 168 GRPVYIELLGKVEPDKLMRVTTVERY 193 >gb|KHG28545.1| Bifunctional dihydrofolate reductase-thymidylate synthase [Gossypium arboreum] Length = 909 Score = 72.8 bits (177), Expect(2) = 8e-17 Identities = 31/39 (79%), Positives = 35/39 (89%) Frame = -1 Query: 383 RWRKDFGTDTIFEDFKFSELDKVLKYFCQSYHGTDKEGR 267 +WRKDFGTDTI EDF+FSELD+VLKY+ Q YHG DKEGR Sbjct: 131 QWRKDFGTDTILEDFEFSELDEVLKYYPQGYHGVDKEGR 169 Score = 41.6 bits (96), Expect(2) = 8e-17 Identities = 16/26 (61%), Positives = 23/26 (88%) Frame = -3 Query: 273 GTPIYIEILGQADPKKLMKVTTIERW 196 G P+YIE+LG+ +P KLM+VTT+ER+ Sbjct: 168 GRPVYIELLGKVEPDKLMRVTTLERY 193 >gb|OMO87538.1| hypothetical protein CCACVL1_08955 [Corchorus capsularis] Length = 878 Score = 69.7 bits (169), Expect(2) = 2e-16 Identities = 29/39 (74%), Positives = 35/39 (89%) Frame = -1 Query: 383 RWRKDFGTDTIFEDFKFSELDKVLKYFCQSYHGTDKEGR 267 +WRKDFGTDTI EDF+F+EL++VLKY+ Q YHG DKEGR Sbjct: 133 QWRKDFGTDTILEDFEFNELNEVLKYYPQGYHGVDKEGR 171 Score = 43.5 bits (101), Expect(2) = 2e-16 Identities = 17/26 (65%), Positives = 23/26 (88%) Frame = -3 Query: 273 GTPIYIEILGQADPKKLMKVTTIERW 196 G P+YIE+LG+ DP KLM+VTT+ER+ Sbjct: 170 GRPVYIELLGKVDPNKLMRVTTLERY 195 >gb|OMO75214.1| hypothetical protein COLO4_26256 [Corchorus olitorius] Length = 878 Score = 69.7 bits (169), Expect(2) = 2e-16 Identities = 29/39 (74%), Positives = 35/39 (89%) Frame = -1 Query: 383 RWRKDFGTDTIFEDFKFSELDKVLKYFCQSYHGTDKEGR 267 +WRKDFGTDTI EDF+F+EL++VLKY+ Q YHG DKEGR Sbjct: 133 QWRKDFGTDTILEDFEFNELNEVLKYYPQGYHGVDKEGR 171 Score = 43.5 bits (101), Expect(2) = 2e-16 Identities = 17/26 (65%), Positives = 23/26 (88%) Frame = -3 Query: 273 GTPIYIEILGQADPKKLMKVTTIERW 196 G P+YIE+LG+ DP KLM+VTT+ER+ Sbjct: 170 GRPVYIELLGKVDPNKLMRVTTLERY 195 >ref|XP_017981301.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer protein SFH8 [Theobroma cacao] Length = 621 Score = 69.7 bits (169), Expect(2) = 2e-16 Identities = 29/39 (74%), Positives = 35/39 (89%) Frame = -1 Query: 383 RWRKDFGTDTIFEDFKFSELDKVLKYFCQSYHGTDKEGR 267 +WRKDFGTDTI EDF+F+EL++VLKY+ Q YHG DKEGR Sbjct: 133 QWRKDFGTDTILEDFEFNELNEVLKYYPQGYHGVDKEGR 171 Score = 43.5 bits (101), Expect(2) = 2e-16 Identities = 17/26 (65%), Positives = 23/26 (88%) Frame = -3 Query: 273 GTPIYIEILGQADPKKLMKVTTIERW 196 G P+YIE+LG+ DP KLM+VTT+ER+ Sbjct: 170 GRPVYIELLGKVDPNKLMRVTTLERY 195 >gb|EOY14829.1| Sec14p-like phosphatidylinositol transfer family protein isoform 1 [Theobroma cacao] gb|EOY14830.1| Sec14p-like phosphatidylinositol transfer family protein isoform 1 [Theobroma cacao] gb|EOY14832.1| Sec14p-like phosphatidylinositol transfer family protein isoform 1 [Theobroma cacao] Length = 621 Score = 69.7 bits (169), Expect(2) = 2e-16 Identities = 29/39 (74%), Positives = 35/39 (89%) Frame = -1 Query: 383 RWRKDFGTDTIFEDFKFSELDKVLKYFCQSYHGTDKEGR 267 +WRKDFGTDTI EDF+F+EL++VLKY+ Q YHG DKEGR Sbjct: 133 QWRKDFGTDTILEDFEFNELNEVLKYYPQGYHGVDKEGR 171 Score = 43.5 bits (101), Expect(2) = 2e-16 Identities = 17/26 (65%), Positives = 23/26 (88%) Frame = -3 Query: 273 GTPIYIEILGQADPKKLMKVTTIERW 196 G P+YIE+LG+ DP KLM+VTT+ER+ Sbjct: 170 GRPVYIELLGKVDPNKLMRVTTLERY 195 >gb|EOY14831.1| Sec14p-like phosphatidylinositol transfer family protein isoform 3 [Theobroma cacao] gb|EOY14833.1| Sec14p-like phosphatidylinositol transfer family protein isoform 3 [Theobroma cacao] Length = 620 Score = 69.7 bits (169), Expect(2) = 2e-16 Identities = 29/39 (74%), Positives = 35/39 (89%) Frame = -1 Query: 383 RWRKDFGTDTIFEDFKFSELDKVLKYFCQSYHGTDKEGR 267 +WRKDFGTDTI EDF+F+EL++VLKY+ Q YHG DKEGR Sbjct: 133 QWRKDFGTDTILEDFEFNELNEVLKYYPQGYHGVDKEGR 171 Score = 43.5 bits (101), Expect(2) = 2e-16 Identities = 17/26 (65%), Positives = 23/26 (88%) Frame = -3 Query: 273 GTPIYIEILGQADPKKLMKVTTIERW 196 G P+YIE+LG+ DP KLM+VTT+ER+ Sbjct: 170 GRPVYIELLGKVDPNKLMRVTTLERY 195 >ref|XP_016687592.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer protein SFH8-like [Gossypium hirsutum] Length = 622 Score = 70.9 bits (172), Expect(2) = 2e-16 Identities = 30/39 (76%), Positives = 35/39 (89%) Frame = -1 Query: 383 RWRKDFGTDTIFEDFKFSELDKVLKYFCQSYHGTDKEGR 267 +WRKDFGTDTI EDF+FSEL++VLKY+ Q YHG DKEGR Sbjct: 131 QWRKDFGTDTILEDFEFSELNEVLKYYPQGYHGVDKEGR 169 Score = 42.0 bits (97), Expect(2) = 2e-16 Identities = 16/26 (61%), Positives = 23/26 (88%) Frame = -3 Query: 273 GTPIYIEILGQADPKKLMKVTTIERW 196 G P+YIE+LG+ +P KLM+VTT+ER+ Sbjct: 168 GRPVYIELLGKVEPDKLMRVTTVERY 193 >gb|KJB58224.1| hypothetical protein B456_009G199800 [Gossypium raimondii] Length = 867 Score = 70.9 bits (172), Expect(2) = 3e-16 Identities = 30/39 (76%), Positives = 35/39 (89%) Frame = -1 Query: 383 RWRKDFGTDTIFEDFKFSELDKVLKYFCQSYHGTDKEGR 267 +WRKDFGTDTI EDF+FSEL++VLKY+ Q YHG DKEGR Sbjct: 131 QWRKDFGTDTILEDFEFSELNEVLKYYPQGYHGVDKEGR 169 Score = 41.6 bits (96), Expect(2) = 3e-16 Identities = 16/26 (61%), Positives = 23/26 (88%) Frame = -3 Query: 273 GTPIYIEILGQADPKKLMKVTTIERW 196 G P+YIE+LG+ +P KLM+VTT+ER+ Sbjct: 168 GRPVYIELLGKVEPDKLMRVTTLERY 193 >ref|XP_012444856.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer protein SFH6 isoform X1 [Gossypium raimondii] Length = 652 Score = 70.9 bits (172), Expect(2) = 3e-16 Identities = 30/39 (76%), Positives = 35/39 (89%) Frame = -1 Query: 383 RWRKDFGTDTIFEDFKFSELDKVLKYFCQSYHGTDKEGR 267 +WRKDFGTDTI EDF+FSEL++VLKY+ Q YHG DKEGR Sbjct: 161 QWRKDFGTDTILEDFEFSELNEVLKYYPQGYHGVDKEGR 199 Score = 41.6 bits (96), Expect(2) = 3e-16 Identities = 16/26 (61%), Positives = 23/26 (88%) Frame = -3 Query: 273 GTPIYIEILGQADPKKLMKVTTIERW 196 G P+YIE+LG+ +P KLM+VTT+ER+ Sbjct: 198 GRPVYIELLGKVEPDKLMRVTTLERY 223 >gb|KJB58223.1| hypothetical protein B456_009G199800 [Gossypium raimondii] Length = 623 Score = 70.9 bits (172), Expect(2) = 3e-16 Identities = 30/39 (76%), Positives = 35/39 (89%) Frame = -1 Query: 383 RWRKDFGTDTIFEDFKFSELDKVLKYFCQSYHGTDKEGR 267 +WRKDFGTDTI EDF+FSEL++VLKY+ Q YHG DKEGR Sbjct: 131 QWRKDFGTDTILEDFEFSELNEVLKYYPQGYHGVDKEGR 169 Score = 41.6 bits (96), Expect(2) = 3e-16 Identities = 16/26 (61%), Positives = 23/26 (88%) Frame = -3 Query: 273 GTPIYIEILGQADPKKLMKVTTIERW 196 G P+YIE+LG+ +P KLM+VTT+ER+ Sbjct: 168 GRPVYIELLGKVEPDKLMRVTTLERY 193 >ref|XP_012444857.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer protein SFH8 isoform X2 [Gossypium raimondii] gb|KJB58221.1| hypothetical protein B456_009G199800 [Gossypium raimondii] Length = 622 Score = 70.9 bits (172), Expect(2) = 3e-16 Identities = 30/39 (76%), Positives = 35/39 (89%) Frame = -1 Query: 383 RWRKDFGTDTIFEDFKFSELDKVLKYFCQSYHGTDKEGR 267 +WRKDFGTDTI EDF+FSEL++VLKY+ Q YHG DKEGR Sbjct: 131 QWRKDFGTDTILEDFEFSELNEVLKYYPQGYHGVDKEGR 169 Score = 41.6 bits (96), Expect(2) = 3e-16 Identities = 16/26 (61%), Positives = 23/26 (88%) Frame = -3 Query: 273 GTPIYIEILGQADPKKLMKVTTIERW 196 G P+YIE+LG+ +P KLM+VTT+ER+ Sbjct: 168 GRPVYIELLGKVEPDKLMRVTTLERY 193 >ref|XP_012444858.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer protein SFH8 isoform X3 [Gossypium raimondii] Length = 614 Score = 70.9 bits (172), Expect(2) = 3e-16 Identities = 30/39 (76%), Positives = 35/39 (89%) Frame = -1 Query: 383 RWRKDFGTDTIFEDFKFSELDKVLKYFCQSYHGTDKEGR 267 +WRKDFGTDTI EDF+FSEL++VLKY+ Q YHG DKEGR Sbjct: 161 QWRKDFGTDTILEDFEFSELNEVLKYYPQGYHGVDKEGR 199 Score = 41.6 bits (96), Expect(2) = 3e-16 Identities = 16/26 (61%), Positives = 23/26 (88%) Frame = -3 Query: 273 GTPIYIEILGQADPKKLMKVTTIERW 196 G P+YIE+LG+ +P KLM+VTT+ER+ Sbjct: 198 GRPVYIELLGKVEPDKLMRVTTLERY 223 >gb|KJB58222.1| hypothetical protein B456_009G199800 [Gossypium raimondii] Length = 598 Score = 70.9 bits (172), Expect(2) = 3e-16 Identities = 30/39 (76%), Positives = 35/39 (89%) Frame = -1 Query: 383 RWRKDFGTDTIFEDFKFSELDKVLKYFCQSYHGTDKEGR 267 +WRKDFGTDTI EDF+FSEL++VLKY+ Q YHG DKEGR Sbjct: 131 QWRKDFGTDTILEDFEFSELNEVLKYYPQGYHGVDKEGR 169 Score = 41.6 bits (96), Expect(2) = 3e-16 Identities = 16/26 (61%), Positives = 23/26 (88%) Frame = -3 Query: 273 GTPIYIEILGQADPKKLMKVTTIERW 196 G P+YIE+LG+ +P KLM+VTT+ER+ Sbjct: 168 GRPVYIELLGKVEPDKLMRVTTLERY 193 >ref|XP_012444860.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer protein SFH6 isoform X4 [Gossypium raimondii] Length = 504 Score = 70.9 bits (172), Expect(2) = 3e-16 Identities = 30/39 (76%), Positives = 35/39 (89%) Frame = -1 Query: 383 RWRKDFGTDTIFEDFKFSELDKVLKYFCQSYHGTDKEGR 267 +WRKDFGTDTI EDF+FSEL++VLKY+ Q YHG DKEGR Sbjct: 161 QWRKDFGTDTILEDFEFSELNEVLKYYPQGYHGVDKEGR 199 Score = 41.6 bits (96), Expect(2) = 3e-16 Identities = 16/26 (61%), Positives = 23/26 (88%) Frame = -3 Query: 273 GTPIYIEILGQADPKKLMKVTTIERW 196 G P+YIE+LG+ +P KLM+VTT+ER+ Sbjct: 198 GRPVYIELLGKVEPDKLMRVTTLERY 223 >ref|XP_012071909.1| phosphatidylinositol/phosphatidylcholine transfer protein SFH8 [Jatropha curcas] gb|KDP38545.1| hypothetical protein JCGZ_04470 [Jatropha curcas] Length = 619 Score = 72.8 bits (177), Expect(2) = 4e-16 Identities = 31/39 (79%), Positives = 35/39 (89%) Frame = -1 Query: 383 RWRKDFGTDTIFEDFKFSELDKVLKYFCQSYHGTDKEGR 267 +WRKDFGTDTI EDF+FSELD+VLKY+ Q YHG DKEGR Sbjct: 132 QWRKDFGTDTIMEDFEFSELDEVLKYYPQGYHGVDKEGR 170 Score = 39.3 bits (90), Expect(2) = 4e-16 Identities = 16/26 (61%), Positives = 22/26 (84%) Frame = -3 Query: 273 GTPIYIEILGQADPKKLMKVTTIERW 196 G P+YIE LG+ DP KLM+VT++ER+ Sbjct: 169 GRPVYIERLGKVDPSKLMQVTSMERY 194 >ref|XP_017607738.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer protein SFH8 [Gossypium arboreum] Length = 622 Score = 70.1 bits (170), Expect(2) = 5e-16 Identities = 30/39 (76%), Positives = 34/39 (87%) Frame = -1 Query: 383 RWRKDFGTDTIFEDFKFSELDKVLKYFCQSYHGTDKEGR 267 +WRKDFGTDTI E F+FSELD+VLKY+ Q YHG DKEGR Sbjct: 131 QWRKDFGTDTILEGFEFSELDEVLKYYPQGYHGVDKEGR 169 Score = 41.6 bits (96), Expect(2) = 5e-16 Identities = 16/26 (61%), Positives = 23/26 (88%) Frame = -3 Query: 273 GTPIYIEILGQADPKKLMKVTTIERW 196 G P+YIE+LG+ +P KLM+VTT+ER+ Sbjct: 168 GRPVYIELLGKVEPDKLMRVTTLERY 193