BLASTX nr result
ID: Chrysanthemum22_contig00017552
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00017552 (595 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AJE73057.1| ribosomal protein L20 (plastid) [Xanthisma spinul... 173 1e-52 ref|YP_009154808.1| ribosomal protein L20 (chloroplast) [Aster s... 173 2e-52 gb|ATC70048.1| ribosomal protein L20 (chloroplast) [Atractylodes... 173 2e-52 ref|YP_009372338.1| ribosomal protein L20 (chloroplast) [Diplost... 173 2e-52 ref|YP_001837383.1| ribosomal protein L20 [Guizotia abyssinica] ... 173 2e-52 ref|YP_009139811.1| ribosomal protein L20 (chloroplast) [Cynara ... 173 2e-52 ref|YP_009040823.1| ribosomal protein L20 (chloroplast) (chlorop... 173 2e-52 ref|YP_004564395.1| ribosomal protein L20 (chloroplast) [Agerati... 173 2e-52 gb|AJE73892.1| ribosomal protein L20 (plastid) [Vernonia baldwin... 173 3e-52 ref|YP_004465210.1| ribosomal protein L20 [Jacobaea vulgaris] >g... 172 4e-52 ref|YP_009373854.1| ribosomal protein L20 (chloroplast) [Soliva ... 172 5e-52 ref|YP_009372083.1| ribosomal protein L20 (chloroplast) [Llerasi... 172 5e-52 ref|YP_009374958.1| ribosomal protein L20 (chloroplast) [Exostig... 172 5e-52 ref|YP_009373599.1| ribosomal protein L20 (chloroplast) [Archiba... 172 5e-52 ref|YP_009318019.1| ribosomal protein L20 (chloroplast) [Galinso... 172 5e-52 gb|AJE74956.1| ribosomal protein L20 (plastid) [Achillea millefo... 172 5e-52 gb|OTG26988.1| putative ribosomal protein L20 [Helianthus annuus] 172 8e-52 ref|YP_588140.1| ribosomal protein L20 (chloroplast) [Helianthus... 172 8e-52 ref|YP_009447389.1| ribosomal protein L20 (chloroplast) [Achyrac... 171 1e-51 gb|AJE73436.1| ribosomal protein L20 (plastid) [Antennaria howel... 171 1e-51 >gb|AJE73057.1| ribosomal protein L20 (plastid) [Xanthisma spinulosum] Length = 117 Score = 173 bits (439), Expect = 1e-52 Identities = 88/88 (100%), Positives = 88/88 (100%) Frame = -1 Query: 265 LFASSFRGAHSRLTRTITQQKIRALVSAHRDRDRQKINFRRLWITRINAAIRERGVCYSY 86 LFASSFRGAHSRLTRTITQQKIRALVSAHRDRDRQKINFRRLWITRINAAIRERGVCYSY Sbjct: 19 LFASSFRGAHSRLTRTITQQKIRALVSAHRDRDRQKINFRRLWITRINAAIRERGVCYSY 78 Query: 85 SRLINDLYKRQLLLNRKILAQIAISNRN 2 SRLINDLYKRQLLLNRKILAQIAISNRN Sbjct: 79 SRLINDLYKRQLLLNRKILAQIAISNRN 106 >ref|YP_009154808.1| ribosomal protein L20 (chloroplast) [Aster spathulifolius] ref|YP_009377933.1| ribosomal protein L20 (chloroplast) [Diplostephium coriaceum] gb|AGX29630.1| ribosomal protein L20 (chloroplast) [Aster spathulifolius] gb|ARH09772.1| ribosomal protein L20 (chloroplast) [Diplostephium coriaceum] Length = 120 Score = 173 bits (439), Expect = 2e-52 Identities = 88/88 (100%), Positives = 88/88 (100%) Frame = -1 Query: 265 LFASSFRGAHSRLTRTITQQKIRALVSAHRDRDRQKINFRRLWITRINAAIRERGVCYSY 86 LFASSFRGAHSRLTRTITQQKIRALVSAHRDRDRQKINFRRLWITRINAAIRERGVCYSY Sbjct: 19 LFASSFRGAHSRLTRTITQQKIRALVSAHRDRDRQKINFRRLWITRINAAIRERGVCYSY 78 Query: 85 SRLINDLYKRQLLLNRKILAQIAISNRN 2 SRLINDLYKRQLLLNRKILAQIAISNRN Sbjct: 79 SRLINDLYKRQLLLNRKILAQIAISNRN 106 >gb|ATC70048.1| ribosomal protein L20 (chloroplast) [Atractylodes lancea] Length = 126 Score = 173 bits (439), Expect = 2e-52 Identities = 88/88 (100%), Positives = 88/88 (100%) Frame = -1 Query: 265 LFASSFRGAHSRLTRTITQQKIRALVSAHRDRDRQKINFRRLWITRINAAIRERGVCYSY 86 LFASSFRGAHSRLTRTITQQKIRALVSAHRDRDRQKINFRRLWITRINAAIRERGVCYSY Sbjct: 19 LFASSFRGAHSRLTRTITQQKIRALVSAHRDRDRQKINFRRLWITRINAAIRERGVCYSY 78 Query: 85 SRLINDLYKRQLLLNRKILAQIAISNRN 2 SRLINDLYKRQLLLNRKILAQIAISNRN Sbjct: 79 SRLINDLYKRQLLLNRKILAQIAISNRN 106 >ref|YP_009372338.1| ribosomal protein L20 (chloroplast) [Diplostephium spinulosum] gb|ARH08073.1| ribosomal protein L20 (chloroplast) [Diplostephium spinulosum] Length = 126 Score = 173 bits (439), Expect = 2e-52 Identities = 88/88 (100%), Positives = 88/88 (100%) Frame = -1 Query: 265 LFASSFRGAHSRLTRTITQQKIRALVSAHRDRDRQKINFRRLWITRINAAIRERGVCYSY 86 LFASSFRGAHSRLTRTITQQKIRALVSAHRDRDRQKINFRRLWITRINAAIRERGVCYSY Sbjct: 19 LFASSFRGAHSRLTRTITQQKIRALVSAHRDRDRQKINFRRLWITRINAAIRERGVCYSY 78 Query: 85 SRLINDLYKRQLLLNRKILAQIAISNRN 2 SRLINDLYKRQLLLNRKILAQIAISNRN Sbjct: 79 SRLINDLYKRQLLLNRKILAQIAISNRN 106 >ref|YP_001837383.1| ribosomal protein L20 [Guizotia abyssinica] ref|YP_007353789.1| ribosomal protein L20 (chloroplast) [Chrysanthemum x morifolium] ref|YP_007474752.1| ribosomal protein L20 (chloroplast) [Chrysanthemum indicum] ref|YP_007624818.1| ribosomal protein L20 (chloroplast) [Artemisia frigida] ref|YP_009111760.1| ribosomal protein L20 (chloroplast) [Artemisia montana] ref|YP_009272100.1| ribsomal protein L20 (chloroplast) [Artemisia argyi] ref|YP_009271491.1| ribosomal protein L20 (chloroplast) [Eclipta prostrata] ref|YP_009307775.1| ribosomal protein L20 (chloroplast) [Artemisia gmelinii] ref|YP_009307863.1| ribosomal protein L20 (chloroplast) [Artemisia capillaris] ref|YP_009365264.1| ribosomal protein L20 (plastid) [Artemisia annua] sp|B2LML6.1|RK20_GUIAB RecName: Full=50S ribosomal protein L20, chloroplastic gb|ACB86550.1| ribosomal protein L20 (chloroplast) [Guizotia abyssinica] gb|AEX99301.1| ribosomal protein L20 (chloroplast) [Chrysanthemum indicum] gb|AEX99537.1| ribosomal protein L20 (chloroplast) [Chrysanthemum indicum] gb|AFA45297.1| ribosomal protein L20 (chloroplast) [Chrysanthemum x morifolium] gb|AFP98844.1| ribosomal protein L20 (chloroplast) [Artemisia frigida] gb|AHJ61168.1| ribosomal protein L20 (chloroplast) [Artemisia montana] gb|AJB98651.1| ribsomal protein L20 (chloroplast) [Artemisia argyi] gb|AJE73968.1| ribosomal protein L20 (plastid) [Helenium flexuosum] gb|AJE74576.1| ribosomal protein L20 (plastid) [Ratibida columnifera] gb|AJE74728.1| ribosomal protein L20 (plastid) [Hymenopappus tenuifolius] gb|AKZ23571.1| ribosomal protein L20 (plastid) [Rudbeckia hirta var. pulcherrima] gb|AKZ23572.1| ribosomal protein L20 (plastid) [Silphium integrifolium] gb|ANS11280.1| ribosomal protein L20 (chloroplast) [Artemisia fukudo] gb|ANW47985.1| ribosomal protein L20 (chloroplast) [Eclipta prostrata] gb|AOR82609.1| ribosomal protein L20 (chloroplast) [Artemisia gmelinii] gb|AOR82697.1| ribosomal protein L20 (chloroplast) [Artemisia capillaris] gb|ARJ60792.1| ribosomal protein L20 (plastid) [Artemisia annua] gb|ARU07833.1| ribosomal protein L20 (chloroplast) [Artemisia gmelinii] gb|ARU07921.1| ribosomal protein L20 (chloroplast) [Artemisia capillaris] gb|ATL16579.1| ribosomal protein L20 (chloroplast) [Artemisia princeps] gb|ATL16641.1| ribosomal protein L20 (chloroplast) [Artemisia argyrophylla] gb|ATL16703.1| ribosomal protein L20 (chloroplast) [Artemisia montana] gb|ATL16963.1| ribosomal protein L20 (chloroplast) [Chrysanthemum zawadskii subsp. coreanum] gb|ATU84273.1| ribosomal protein L20 (chloroplast) [Artemisia annua] gb|AVI25932.1| ribosomal protein L20 (chloroplast) [Chrysanthemum boreale] Length = 126 Score = 173 bits (439), Expect = 2e-52 Identities = 88/88 (100%), Positives = 88/88 (100%) Frame = -1 Query: 265 LFASSFRGAHSRLTRTITQQKIRALVSAHRDRDRQKINFRRLWITRINAAIRERGVCYSY 86 LFASSFRGAHSRLTRTITQQKIRALVSAHRDRDRQKINFRRLWITRINAAIRERGVCYSY Sbjct: 19 LFASSFRGAHSRLTRTITQQKIRALVSAHRDRDRQKINFRRLWITRINAAIRERGVCYSY 78 Query: 85 SRLINDLYKRQLLLNRKILAQIAISNRN 2 SRLINDLYKRQLLLNRKILAQIAISNRN Sbjct: 79 SRLINDLYKRQLLLNRKILAQIAISNRN 106 >ref|YP_009139811.1| ribosomal protein L20 (chloroplast) [Cynara humilis] ref|YP_009169517.1| ribosomal protein L20 (chloroplast) [Cynara baetica] ref|YP_009169604.1| ribosomal protein L20 (chloroplast) [Cynara cornigera] ref|YP_009235744.1| ribosomal protein L20 (chloroplast) [Saussurea involucrata] ref|YP_009372253.1| ribosomal protein L20 (chloroplast) [Diplostephium huertasii] ref|YP_009372508.1| ribosomal protein L20 (chloroplast) [Diplostephium obtusum] ref|YP_009371743.1| ribosomal protein L20 (chloroplast) [Diplostephium oxapampanum] ref|YP_009371488.1| ribosomal protein L20 (chloroplast) [Diplostephium lechleri] ref|YP_009371913.1| ribosomal protein L20 (chloroplast) [Diplostephium violaceum] ref|YP_009371998.1| ribosomal protein L20 (chloroplast) [Diplostephium oblongifolium] ref|YP_009371573.1| ribosomal protein L20 (chloroplast) [Lagenophora cuchumatanica] ref|YP_009372423.1| ribosomal protein L20 (chloroplast) [Diplostephium meyenii] ref|YP_009372593.1| ribosomal protein L20 (chloroplast) [Diplostephium tachirense] ref|YP_009372763.1| ribosomal protein L20 (chloroplast) [Diplostephium mutiscuanum] ref|YP_009372848.1| ribosomal protein L20 (chloroplast) [Diplostephium sagasteguii] ref|YP_009372933.1| ribosomal protein L20 (chloroplast) [Diplostephium jenesanum] ref|YP_009373102.1| ribosomal protein L20 (chloroplast) [Diplostephium hippophae] ref|YP_009373514.1| ribosomal protein L20 (chloroplast) [Diplostephium alveolatum] ref|YP_009373769.1| ribosomal protein L20 (chloroplast) [Diplostephium cinerascens] ref|YP_009374193.1| ribosomal protein L20 (chloroplast) [Heterothalamus alienus] ref|YP_009374278.1| ribosomal protein L20 (chloroplast) [Diplostephium callilepis] ref|YP_009374448.1| ribosomal protein L20 (chloroplast) [Laestadia muscicola] ref|YP_009374788.1| ribosomal protein L20 (chloroplast) [Diplostephium gynoxyoides] ref|YP_009376573.1| ribosomal protein L20 (chloroplast) [Diplostephium foliosissimum] ref|YP_009376658.1| ribosomal protein L20 (chloroplast) [Hinterhubera ericoides] ref|YP_009376828.1| ribosomal protein L20 (chloroplast) [Diplostephium cayambense] ref|YP_009376998.1| ribosomal protein L20 (chloroplast) [Floscaldasia hypsophila] ref|YP_009377168.1| ribosomal protein L20 (chloroplast) [Parastrephia quadrangularis] ref|YP_009377508.1| ribosomal protein L20 (chloroplast) [Diplostephium jaramilloi] ref|YP_009377678.1| ribosomal protein L20 (chloroplast) [Diplostephium heterophyllum] ref|YP_009377763.1| ribosomal protein L20 (chloroplast) [Diplostephium camargoanum] ref|YP_009378273.1| ribosomal protein L20 (chloroplast) [Diplostephium ochraceum] ref|YP_009374023.1| ribosomal protein L20 (chloroplast) [Diplostephium barclayanum] ref|YP_009374703.1| ribosomal protein L20 (chloroplast) [Diplostephium colombianum] ref|YP_009374873.1| ribosomal protein L20 (chloroplast) [Diplostephium revolutum] ref|YP_009375043.1| ribosomal protein L20 (chloroplast) [Diplostephium rupestre] ref|YP_009375128.1| ribosomal protein L20 (chloroplast) [Blakiella bartsiifolia] ref|YP_009375383.1| ribosomal protein L20 (chloroplast) [Diplostephium cinereum] ref|YP_009375468.1| ribosomal protein L20 (chloroplast) [Diplostephium ericoides] ref|YP_009375553.1| ribosomal protein L20 (chloroplast) [Diplostephium haenkei] ref|YP_009375723.1| ribosomal protein L20 (chloroplast) [Diplostephium phylicoides] ref|YP_009375808.1| ribosomal protein L20 (chloroplast) [Diplostephium eriophorum] ref|YP_009375893.1| ribosomal protein L20 (chloroplast) [Diplostephium glutinosum] ref|YP_009375978.1| ribosomal protein L20 (chloroplast) [Diplostephium antioquense] ref|YP_009376063.1| ribosomal protein L20 (chloroplast) [Laennecia sophiifolia] ref|YP_009376148.1| ribosomal protein L20 (chloroplast) [Diplostephium lacunosum] ref|YP_009376233.1| ribosomal protein L20 (chloroplast) [Diplostephium costaricense] ref|YP_009376403.1| ribosomal protein L20 (chloroplast) [Diplostephium crypteriophyllum] ref|YP_009376743.1| ribosomal protein L20 (chloroplast) [Diplostephium romeroi] ref|YP_009376913.1| ribosomal protein L20 (chloroplast) [Diplostephium venezuelense] ref|YP_009377338.1| ribosomal protein L20 (chloroplast) [Diplostephium schultzii] ref|YP_009377423.1| ribosomal protein L20 (chloroplast) [Diplostephium frontinense] ref|YP_009377593.1| ribosomal protein L20 (chloroplast) [Diplostephium inesianum] ref|YP_009378018.1| ribosomal protein L20 (chloroplast) [Diplostephium rosmarinifolium] ref|YP_009378103.1| ribosomal protein L20 (chloroplast) [Diplostephium goodspeedii] ref|YP_009378188.1| ribosomal protein L20 (chloroplast) [Diplostephium apiculatum] ref|YP_009383559.1| ribosomal protein L20 (chloroplast) [Aster altaicus] ref|YP_009428492.1| ribosomal protein L20 (chloroplast) [Conyza bonariensis] ref|YP_009446374.1| ribosomal protein L20 (chloroplast) [Saussurea polylepis] ref|YP_009450405.1| ribosomal protein L20 (chloroplast) [Saussurea chabyoungsanica] gb|AJE73131.1| ribosomal protein L20 (plastid) [Gutierrezia sarothrae] gb|AJE73359.1| ribosomal protein L20 (plastid) [Erigeron strigosus] gb|AJE73663.1| ribosomal protein L20 (plastid) [Erigeron philadelphicus] gb|AJE73739.1| ribosomal protein L20 (plastid) [Heterotheca stenophylla] gb|AJE74043.1| ribosomal protein L20 (plastid) [Heterotheca villosa] gb|AJE75031.1| ribosomal protein L20 (plastid) [Erigeron bellidiastrum] gb|AKG49819.1| ribosomal protein L20 (chloroplast) [Cynara humilis] gb|AKH02230.1| ribosomal protein L20 (chloroplast) [Cynara cardunculus var. scolymus] gb|AKQ49468.1| ribosomal protein L20 (chloroplast) [Cynara baetica] gb|AKQ49555.1| ribosomal protein L20 (chloroplast) [Cynara cornigera] gb|AKQ50860.1| ribosomal protein L20 (chloroplast) [Cynara syriaca] gb|AMD61901.1| ribosomal protein L20 (chloroplast) [Saussurea involucrata] gb|APZ75498.1| ribosomal protein L20 (chloroplast) [Saussurea chabyoungsanica] gb|AQX33546.1| ribosomal protein L20 (chloroplast) [Pityopsis falcata] gb|ARH02889.1| ribosomal protein L20 (chloroplast) [Diplostephium alveolatum] gb|ARH03399.1| ribosomal protein L20 (chloroplast) [Diplostephium cinerascens] gb|ARH03653.1| ribosomal protein L20 (chloroplast) [Diplostephium barclayanum] gb|ARH03908.1| ribosomal protein L20 (chloroplast) [Diplostephium lechleri] gb|ARH03993.1| ribosomal protein L20 (chloroplast) [Heterothalamus alienus] gb|ARH04078.1| ribosomal protein L20 (chloroplast) [Diplostephium callilepis] gb|ARH04333.1| ribosomal protein L20 (chloroplast) [Laestadia muscicola] gb|ARH04588.1| ribosomal protein L20 (chloroplast) [Diplostephium colombianum] gb|ARH04673.1| ribosomal protein L20 (chloroplast) [Diplostephium gynoxyoides] gb|ARH04758.1| ribosomal protein L20 (chloroplast) [Diplostephium revolutum] gb|ARH04843.1| ribosomal protein L20 (chloroplast) [Lagenophora cuchumatanica] gb|ARH05098.1| ribosomal protein L20 (chloroplast) [Diplostephium rupestre] gb|ARH05268.1| ribosomal protein L20 (chloroplast) [Diplostephium oxapampanum] gb|ARH05438.1| ribosomal protein L20 (chloroplast) [Blakiella bartsiifolia] gb|ARH05693.1| ribosomal protein L20 (chloroplast) [Diplostephium cinereum] gb|ARH05778.1| ribosomal protein L20 (chloroplast) [Diplostephium rhomboidale] gb|ARH05863.1| ribosomal protein L20 (chloroplast) [Diplostephium violaceum] gb|ARH05948.1| ribosomal protein L20 (chloroplast) [Diplostephium ericoides] gb|ARH06033.1| ribosomal protein L20 (chloroplast) [Diplostephium haenkei] gb|ARH06203.1| ribosomal protein L20 (chloroplast) [Diplostephium phylicoides] gb|ARH06288.1| ribosomal protein L20 (chloroplast) [Diplostephium eriophorum] gb|ARH06373.1| ribosomal protein L20 (chloroplast) [Diplostephium glutinosum] gb|ARH06458.1| ribosomal protein L20 (chloroplast) [Diplostephium antioquense] gb|ARH06543.1| ribosomal protein L20 (chloroplast) [Laennecia sophiifolia] gb|ARH06628.1| ribosomal protein L20 (chloroplast) [Diplostephium lacunosum] gb|ARH06713.1| ribosomal protein L20 (chloroplast) [Diplostephium costaricense] gb|ARH07053.1| ribosomal protein L20 (chloroplast) [Diplostephium crypteriophyllum] gb|ARH07138.1| ribosomal protein L20 (chloroplast) [Diplostephium oblongifolium] gb|ARH07393.1| ribosomal protein L20 (chloroplast) [Diplostephium foliosissimum] gb|ARH07478.1| ribosomal protein L20 (chloroplast) [Hinterhubera ericoides] gb|ARH07563.1| ribosomal protein L20 (chloroplast) [Diplostephium romeroi] gb|ARH07648.1| ribosomal protein L20 (chloroplast) [Diplostephium cayambense] gb|ARH07818.1| ribosomal protein L20 (chloroplast) [Diplostephium venezuelense] gb|ARH07903.1| ribosomal protein L20 (chloroplast) [Diplostephium huertasii] gb|ARH07988.1| ribosomal protein L20 (chloroplast) [Floscaldasia hypsophila] gb|ARH08243.1| ribosomal protein L20 (chloroplast) [Diplostephium meyenii] gb|ARH08328.1| ribosomal protein L20 (chloroplast) [Diplostephium obtusum] gb|ARH08498.1| ribosomal protein L20 (chloroplast) [Diplostephium tachirense] gb|ARH08583.1| ribosomal protein L20 (chloroplast) [Parastrephia quadrangularis] gb|ARH08838.1| ribosomal protein L20 (chloroplast) [Diplostephium schultzii] gb|ARH08923.1| ribosomal protein L20 (chloroplast) [Diplostephium frontinense] gb|ARH09008.1| ribosomal protein L20 (chloroplast) [Diplostephium jaramilloi] gb|ARH09093.1| ribosomal protein L20 (chloroplast) [Diplostephium mutiscuanum] gb|ARH09178.1| ribosomal protein L20 (chloroplast) [Diplostephium inesianum] gb|ARH09263.1| ribosomal protein L20 (chloroplast) [Diplostephium heterophyllum] gb|ARH09348.1| ribosomal protein L20 (chloroplast) [Diplostephium sagasteguii] gb|ARH09433.1| ribosomal protein L20 (chloroplast) [Diplostephium camargoanum] gb|ARH09518.1| ribosomal protein L20 (chloroplast) [Diplostephium jenesanum] gb|ARH09942.1| ribosomal protein L20 (chloroplast) [Diplostephium rosmarinifolium] gb|ARH10027.1| ribosomal protein L20 (chloroplast) [Diplostephium goodspeedii] gb|ARH10282.1| ribosomal protein L20 (chloroplast) [Diplostephium apiculatum] gb|ARH10367.1| ribosomal protein L20 (chloroplast) [Diplostephium hippophae] gb|ARH10452.1| ribosomal protein L20 (chloroplast) [Diplostephium ochraceum] gb|ARH10537.1| ribosomal protein L20 (chloroplast) [Diplostephium sp. CAJ2] gb|ARO73715.1| ribosomal protein L20 (chloroplast) [Conyza bonariensis] gb|ARR27856.1| ribosomal protein L20 (chloroplast) [Aster altaicus] gb|ASW20553.1| ribosomal protein L20 (chloroplast) [Conyza bonariensis] gb|ATY40808.1| ribosomal protein L20 (chloroplast) [Saussurea polylepis] Length = 126 Score = 173 bits (439), Expect = 2e-52 Identities = 88/88 (100%), Positives = 88/88 (100%) Frame = -1 Query: 265 LFASSFRGAHSRLTRTITQQKIRALVSAHRDRDRQKINFRRLWITRINAAIRERGVCYSY 86 LFASSFRGAHSRLTRTITQQKIRALVSAHRDRDRQKINFRRLWITRINAAIRERGVCYSY Sbjct: 19 LFASSFRGAHSRLTRTITQQKIRALVSAHRDRDRQKINFRRLWITRINAAIRERGVCYSY 78 Query: 85 SRLINDLYKRQLLLNRKILAQIAISNRN 2 SRLINDLYKRQLLLNRKILAQIAISNRN Sbjct: 79 SRLINDLYKRQLLLNRKILAQIAISNRN 106 >ref|YP_009040823.1| ribosomal protein L20 (chloroplast) (chloroplast) [Centaurea diffusa] ref|YP_009271928.1| ribosomal protein L20 (chloroplast) [Carthamus tinctorius] gb|AIB03777.1| ribosomal protein L20 (chloroplast) (chloroplast) [Centaurea diffusa] gb|AIY72410.1| ribosomal protein L20 (chloroplast) [Carthamus tinctorius] gb|AKJ77473.1| ribosomal protein L20 (chloroplast) [Carthamus tinctorius] gb|APD83361.1| ribosomal protein L20 (chloroplast) [Carthamus tinctorius] Length = 126 Score = 173 bits (439), Expect = 2e-52 Identities = 88/88 (100%), Positives = 88/88 (100%) Frame = -1 Query: 265 LFASSFRGAHSRLTRTITQQKIRALVSAHRDRDRQKINFRRLWITRINAAIRERGVCYSY 86 LFASSFRGAHSRLTRTITQQKIRALVSAHRDRDRQKINFRRLWITRINAAIRERGVCYSY Sbjct: 19 LFASSFRGAHSRLTRTITQQKIRALVSAHRDRDRQKINFRRLWITRINAAIRERGVCYSY 78 Query: 85 SRLINDLYKRQLLLNRKILAQIAISNRN 2 SRLINDLYKRQLLLNRKILAQIAISNRN Sbjct: 79 SRLINDLYKRQLLLNRKILAQIAISNRN 106 >ref|YP_004564395.1| ribosomal protein L20 (chloroplast) [Ageratina adenophora] gb|AEG64579.1| ribosomal protein L20 (chloroplast) [Ageratina adenophora] Length = 126 Score = 173 bits (439), Expect = 2e-52 Identities = 88/88 (100%), Positives = 88/88 (100%) Frame = -1 Query: 265 LFASSFRGAHSRLTRTITQQKIRALVSAHRDRDRQKINFRRLWITRINAAIRERGVCYSY 86 LFASSFRGAHSRLTRTITQQKIRALVSAHRDRDRQKINFRRLWITRINAAIRERGVCYSY Sbjct: 19 LFASSFRGAHSRLTRTITQQKIRALVSAHRDRDRQKINFRRLWITRINAAIRERGVCYSY 78 Query: 85 SRLINDLYKRQLLLNRKILAQIAISNRN 2 SRLINDLYKRQLLLNRKILAQIAISNRN Sbjct: 79 SRLINDLYKRQLLLNRKILAQIAISNRN 106 >gb|AJE73892.1| ribosomal protein L20 (plastid) [Vernonia baldwinii] gb|AKZ23573.1| ribosomal protein L20 (plastid) [Vernonia baldwinii] Length = 126 Score = 173 bits (438), Expect = 3e-52 Identities = 87/88 (98%), Positives = 88/88 (100%) Frame = -1 Query: 265 LFASSFRGAHSRLTRTITQQKIRALVSAHRDRDRQKINFRRLWITRINAAIRERGVCYSY 86 LFASSFRGAHSRLTRTITQQKIRALVSAHRDRDRQKINFRRLWITRINAAIRERG+CYSY Sbjct: 19 LFASSFRGAHSRLTRTITQQKIRALVSAHRDRDRQKINFRRLWITRINAAIRERGICYSY 78 Query: 85 SRLINDLYKRQLLLNRKILAQIAISNRN 2 SRLINDLYKRQLLLNRKILAQIAISNRN Sbjct: 79 SRLINDLYKRQLLLNRKILAQIAISNRN 106 >ref|YP_004465210.1| ribosomal protein L20 [Jacobaea vulgaris] ref|YP_009320302.1| ribosomal protein L20 (chloroplast) [Pericallis hybrida] ref|YP_009458057.1| ribosomal protein L20 (chloroplast) [Dendrosenecio keniodendron] ref|YP_009458146.1| ribosomal protein L20 (chloroplast) [Dendrosenecio keniensis] ref|YP_009458234.1| ribosomal protein L20 (chloroplast) [Dendrosenecio battiscombei] gb|ADO15433.1| ribosomal protein L20 (chloroplast) [Jacobaea vulgaris] gb|AJE75184.1| ribosomal protein L20 (plastid) [Senecio integerrimus] gb|ALE65950.1| ribosomal protein L20 (chloroplast) [Pericallis hybrida] gb|AMX21784.1| ribosomal protein L20 (mitochondrion) [Dendrosenecio brassiciformis] gb|ANS58017.1| ribosomal protein L20 (chloroplast) [Ligularia fischeri] gb|ATL57862.1| ribosomal protein L20 (chloroplast) [Dendrosenecio keniodendron] gb|ATL57951.1| ribosomal protein L20 (chloroplast) [Dendrosenecio keniensis] gb|ATL58040.1| ribosomal protein L20 (chloroplast) [Dendrosenecio battiscombei] Length = 120 Score = 172 bits (436), Expect = 4e-52 Identities = 87/88 (98%), Positives = 88/88 (100%) Frame = -1 Query: 265 LFASSFRGAHSRLTRTITQQKIRALVSAHRDRDRQKINFRRLWITRINAAIRERGVCYSY 86 LFASSFRGAHSRLTRTITQQKIRALVSAHRDRD+QKINFRRLWITRINAAIRERGVCYSY Sbjct: 19 LFASSFRGAHSRLTRTITQQKIRALVSAHRDRDKQKINFRRLWITRINAAIRERGVCYSY 78 Query: 85 SRLINDLYKRQLLLNRKILAQIAISNRN 2 SRLINDLYKRQLLLNRKILAQIAISNRN Sbjct: 79 SRLINDLYKRQLLLNRKILAQIAISNRN 106 >ref|YP_009373854.1| ribosomal protein L20 (chloroplast) [Soliva sessilis] gb|ARH03484.1| ribosomal protein L20 (chloroplast) [Soliva sessilis] Length = 124 Score = 172 bits (436), Expect = 5e-52 Identities = 87/88 (98%), Positives = 88/88 (100%) Frame = -1 Query: 265 LFASSFRGAHSRLTRTITQQKIRALVSAHRDRDRQKINFRRLWITRINAAIRERGVCYSY 86 LFASSFRGAHSRLTRTITQQKIRALVSAHRDRD+QKINFRRLWITRINAAIRERGVCYSY Sbjct: 19 LFASSFRGAHSRLTRTITQQKIRALVSAHRDRDKQKINFRRLWITRINAAIRERGVCYSY 78 Query: 85 SRLINDLYKRQLLLNRKILAQIAISNRN 2 SRLINDLYKRQLLLNRKILAQIAISNRN Sbjct: 79 SRLINDLYKRQLLLNRKILAQIAISNRN 106 >ref|YP_009372083.1| ribosomal protein L20 (chloroplast) [Llerasia caucana] gb|ARH07308.1| ribosomal protein L20 (chloroplast) [Llerasia caucana] Length = 126 Score = 172 bits (436), Expect = 5e-52 Identities = 87/88 (98%), Positives = 88/88 (100%) Frame = -1 Query: 265 LFASSFRGAHSRLTRTITQQKIRALVSAHRDRDRQKINFRRLWITRINAAIRERGVCYSY 86 LFASSFRGAHSRLTRTITQQKIRALVSAHRDRD+QKINFRRLWITRINAAIRERGVCYSY Sbjct: 19 LFASSFRGAHSRLTRTITQQKIRALVSAHRDRDKQKINFRRLWITRINAAIRERGVCYSY 78 Query: 85 SRLINDLYKRQLLLNRKILAQIAISNRN 2 SRLINDLYKRQLLLNRKILAQIAISNRN Sbjct: 79 SRLINDLYKRQLLLNRKILAQIAISNRN 106 >ref|YP_009374958.1| ribosomal protein L20 (chloroplast) [Exostigma notobellidiastrum] gb|ARH05013.1| ribosomal protein L20 (chloroplast) [Exostigma notobellidiastrum] Length = 126 Score = 172 bits (436), Expect = 5e-52 Identities = 87/88 (98%), Positives = 88/88 (100%) Frame = -1 Query: 265 LFASSFRGAHSRLTRTITQQKIRALVSAHRDRDRQKINFRRLWITRINAAIRERGVCYSY 86 LFASSFRGAHSRLTRTITQQKIRALVSAHRDRDRQKINFRRLWITRINAAIRE+GVCYSY Sbjct: 19 LFASSFRGAHSRLTRTITQQKIRALVSAHRDRDRQKINFRRLWITRINAAIREKGVCYSY 78 Query: 85 SRLINDLYKRQLLLNRKILAQIAISNRN 2 SRLINDLYKRQLLLNRKILAQIAISNRN Sbjct: 79 SRLINDLYKRQLLLNRKILAQIAISNRN 106 >ref|YP_009373599.1| ribosomal protein L20 (chloroplast) [Archibaccharis asperifolia] gb|ARH03144.1| ribosomal protein L20 (chloroplast) [Archibaccharis asperifolia] Length = 126 Score = 172 bits (436), Expect = 5e-52 Identities = 87/88 (98%), Positives = 88/88 (100%) Frame = -1 Query: 265 LFASSFRGAHSRLTRTITQQKIRALVSAHRDRDRQKINFRRLWITRINAAIRERGVCYSY 86 LFASSFRGAHSRLTRTITQQKI+ALVSAHRDRDRQKINFRRLWITRINAAIRERGVCYSY Sbjct: 19 LFASSFRGAHSRLTRTITQQKIKALVSAHRDRDRQKINFRRLWITRINAAIRERGVCYSY 78 Query: 85 SRLINDLYKRQLLLNRKILAQIAISNRN 2 SRLINDLYKRQLLLNRKILAQIAISNRN Sbjct: 79 SRLINDLYKRQLLLNRKILAQIAISNRN 106 >ref|YP_009318019.1| ribosomal protein L20 (chloroplast) [Galinsoga quadriradiata] gb|AOY41668.1| ribosomal protein L20 (chloroplast) [Galinsoga quadriradiata] Length = 126 Score = 172 bits (436), Expect = 5e-52 Identities = 87/88 (98%), Positives = 88/88 (100%) Frame = -1 Query: 265 LFASSFRGAHSRLTRTITQQKIRALVSAHRDRDRQKINFRRLWITRINAAIRERGVCYSY 86 LFASSFRGAHSRLTRTITQQKIRALVSAHRDRDRQKINFRRLWITRINAAIRE+GVCYSY Sbjct: 19 LFASSFRGAHSRLTRTITQQKIRALVSAHRDRDRQKINFRRLWITRINAAIREKGVCYSY 78 Query: 85 SRLINDLYKRQLLLNRKILAQIAISNRN 2 SRLINDLYKRQLLLNRKILAQIAISNRN Sbjct: 79 SRLINDLYKRQLLLNRKILAQIAISNRN 106 >gb|AJE74956.1| ribosomal protein L20 (plastid) [Achillea millefolium] Length = 126 Score = 172 bits (436), Expect = 5e-52 Identities = 87/88 (98%), Positives = 88/88 (100%) Frame = -1 Query: 265 LFASSFRGAHSRLTRTITQQKIRALVSAHRDRDRQKINFRRLWITRINAAIRERGVCYSY 86 LFASSFRGAHSRLTRTITQQKIRALVSAHRDRD+QKINFRRLWITRINAAIRERGVCYSY Sbjct: 19 LFASSFRGAHSRLTRTITQQKIRALVSAHRDRDKQKINFRRLWITRINAAIRERGVCYSY 78 Query: 85 SRLINDLYKRQLLLNRKILAQIAISNRN 2 SRLINDLYKRQLLLNRKILAQIAISNRN Sbjct: 79 SRLINDLYKRQLLLNRKILAQIAISNRN 106 >gb|OTG26988.1| putative ribosomal protein L20 [Helianthus annuus] Length = 126 Score = 172 bits (435), Expect = 8e-52 Identities = 87/88 (98%), Positives = 87/88 (98%) Frame = -1 Query: 265 LFASSFRGAHSRLTRTITQQKIRALVSAHRDRDRQKINFRRLWITRINAAIRERGVCYSY 86 LFASSFRGAHSRLTRTITQQKIRALVSAHRDRDRQKINFRRLWITRINAAIRERGVCYSY Sbjct: 19 LFASSFRGAHSRLTRTITQQKIRALVSAHRDRDRQKINFRRLWITRINAAIRERGVCYSY 78 Query: 85 SRLINDLYKRQLLLNRKILAQIAISNRN 2 SR INDLYKRQLLLNRKILAQIAISNRN Sbjct: 79 SRFINDLYKRQLLLNRKILAQIAISNRN 106 >ref|YP_588140.1| ribosomal protein L20 (chloroplast) [Helianthus annuus] ref|YP_008964380.1| ribosomal protein L20 [Helianthus divaricatus] ref|YP_008964465.1| ribosomal protein L20 [Helianthus decapetalus] ref|YP_008964720.1| ribosomal protein L20 [Helianthus strumosus] ref|YP_008964805.1| ribosomal protein L20 [Helianthus maximiliani] ref|YP_008964210.1| ribosomal protein L20 [Helianthus giganteus] ref|YP_008964295.1| ribosomal protein L20 [Helianthus grosseserratus] ref|YP_008964550.1| ribosomal protein L20 [Helianthus hirsutus] ref|YP_008964635.1| ribosomal protein L20 [Helianthus tuberosus] ref|YP_009252972.1| ribosomal protein L20 (chloroplast) [Helianthus debilis] ref|YP_009255898.1| ribosomal protein L20 (chloroplast) [Helianthus argophyllus] ref|YP_009354909.1| ribosomal protein L20 (plastid) [Echinacea angustifolia] ref|YP_009354654.1| ribosomal protein L20 (plastid) [Echinacea pallida] ref|YP_009354739.1| ribosomal protein L20 (plastid) [Echinacea laevigata] ref|YP_009354824.1| ribosomal protein L20 (plastid) [Echinacea atrorubens] ref|YP_009354994.1| ribosomal protein L20 (plastid) [Echinacea speciosa] ref|YP_009355079.1| ribosomal protein L20 (plastid) [Echinacea tennesseensis] ref|YP_009355164.1| ribosomal protein L20 (plastid) [Echinacea purpurea] ref|YP_009355249.1| ribosomal protein L20 (plastid) [Echinacea sanguinea] ref|YP_009354569.1| ribosomal protein L20 (plastid) [Echinacea paradoxa] ref|YP_009428014.1| ribosomal protein L20 (chloroplast) [Ambrosia artemisiifolia] ref|YP_009456332.1| ribosomal protein L20 (chloroplast) [Ambrosia trifida] sp|Q1KXT6.1|RK20_HELAN RecName: Full=50S ribosomal protein L20, chloroplastic gb|ABD47169.1| ribosomal protein L20 (chloroplast) [Helianthus annuus] gb|AHB14480.1| ribosomal protein L20 (plastid) [Helianthus giganteus] gb|AHB14565.1| ribosomal protein L20 (plastid) [Helianthus giganteus] gb|AHB14650.1| ribosomal protein L20 (plastid) [Helianthus giganteus] gb|AHB14735.1| ribosomal protein L20 (plastid) [Helianthus giganteus] gb|AHB14820.1| ribosomal protein L20 (plastid) [Helianthus grosseserratus] gb|AHB14905.1| ribosomal protein L20 (plastid) [Helianthus grosseserratus] gb|AHB14990.1| ribosomal protein L20 (plastid) [Helianthus divaricatus] gb|AHB15075.1| ribosomal protein L20 (plastid) [Helianthus divaricatus] gb|AHB15160.1| ribosomal protein L20 (plastid) [Helianthus divaricatus] gb|AHB15245.1| ribosomal protein L20 (plastid) [Helianthus divaricatus] gb|AHB15330.1| ribosomal protein L20 (plastid) [Helianthus decapetalus] gb|AHB15415.1| ribosomal protein L20 (plastid) [Helianthus decapetalus] gb|AHB15500.1| ribosomal protein L20 (plastid) [Helianthus decapetalus] gb|AHB15585.1| ribosomal protein L20 (plastid) [Helianthus hirsutus] gb|AHB15670.1| ribosomal protein L20 (plastid) [Helianthus hirsutus] gb|AHB15755.1| ribosomal protein L20 (plastid) [Helianthus tuberosus] gb|AHB15840.1| ribosomal protein L20 (plastid) [Helianthus tuberosus] gb|AHB15925.1| ribosomal protein L20 (plastid) [Helianthus tuberosus] gb|AHB16010.1| ribosomal protein L20 (plastid) [Helianthus divaricatus] gb|AHB16095.1| ribosomal protein L20 (plastid) [Helianthus giganteus] gb|AHB16180.1| ribosomal protein L20 (plastid) [Helianthus giganteus] gb|AHB16265.1| ribosomal protein L20 (plastid) [Helianthus grosseserratus] gb|AHB16350.1| ribosomal protein L20 (plastid) [Helianthus grosseserratus] gb|AHB16435.1| ribosomal protein L20 (plastid) [Helianthus grosseserratus] gb|AHB16520.1| ribosomal protein L20 (plastid) [Helianthus grosseserratus] gb|AHB16605.1| ribosomal protein L20 (plastid) [Helianthus decapetalus] gb|AHB16690.1| ribosomal protein L20 (plastid) [Helianthus decapetalus] gb|AHB16775.1| ribosomal protein L20 (plastid) [Helianthus decapetalus] gb|AHB16860.1| ribosomal protein L20 (plastid) [Helianthus hirsutus] gb|AHB16945.1| ribosomal protein L20 (plastid) [Helianthus hirsutus] gb|AHB17030.1| ribosomal protein L20 (plastid) [Helianthus strumosus] gb|AHB17115.1| ribosomal protein L20 (plastid) [Helianthus tuberosus] gb|AHB17200.1| ribosomal protein L20 (plastid) [Helianthus tuberosus] gb|AHB17285.1| ribosomal protein L20 (plastid) [Helianthus tuberosus] gb|AHB17370.1| ribosomal protein L20 (plastid) [Helianthus maximiliani] gb|AHB17455.1| ribosomal protein L20 (plastid) [Helianthus maximiliani] gb|AHB17540.1| ribosomal protein L20 (plastid) [Helianthus maximiliani] gb|AHB17625.1| ribosomal protein L20 (plastid) [Helianthus maximiliani] gb|AJE74196.1| ribosomal protein L20 (plastid) [Echinacea angustifolia] gb|AJE74272.1| ribosomal protein L20 (plastid) [Helianthus petiolaris] gb|AJE74424.1| ribosomal protein L20 (plastid) [Helianthus mollis] gb|AKZ23568.1| ribosomal protein L20 (plastid) [Helianthus pauciflorus subsp. subrhomboideus] gb|AKZ23569.1| ribosomal protein L20 (plastid) [Helianthus tuberosus] gb|AMQ33960.1| ribosomal protein L20 (chloroplast) [Helianthus petiolaris subsp. fallax] gb|AMX21494.1| ribosomal protein L20 (chloroplast) [Helianthus praecox] gb|AMX22367.1| ribosomal protein L20 (chloroplast) [Helianthus petiolaris] gb|ANA91231.1| ribosomal protein L20 (chloroplast) [Helianthus debilis] gb|ANB79017.1| ribosomal protein L20 (chloroplast) [Helianthus annuus subsp. texanus] gb|ANF03688.1| ribosomal protein L20 (chloroplast) [Helianthus argophyllus] gb|ANF03924.1| ribosomal protein L20 (plastid) [Helianthus annuus] gb|ARB02748.1| ribosomal protein L20 (plastid) [Echinacea paradoxa] gb|ARB02833.1| ribosomal protein L20 (plastid) [Echinacea pallida] gb|ARB02918.1| ribosomal protein L20 (plastid) [Echinacea laevigata] gb|ARB03003.1| ribosomal protein L20 (plastid) [Echinacea atrorubens] gb|ARB03088.1| ribosomal protein L20 (plastid) [Echinacea angustifolia] gb|ARB03173.1| ribosomal protein L20 (plastid) [Echinacea speciosa] gb|ARB03258.1| ribosomal protein L20 (plastid) [Echinacea tennesseensis] gb|ARB03343.1| ribosomal protein L20 (plastid) [Echinacea purpurea] gb|ARB03428.1| ribosomal protein L20 (plastid) [Echinacea sanguinea] gb|OTF84767.1| putative ribosomal protein L20 (plastid) [Helianthus annuus] gb|OTG07133.1| putative ribosomal protein L20 [Helianthus annuus] gb|OTG10078.1| putative ribosomal protein L20 [Helianthus annuus] gb|OTG10137.1| putative ribosomal protein L20 [Helianthus annuus] gb|OTG13220.1| putative ribosomal protein L20 [Helianthus annuus] gb|OTG26911.1| putative ribosomal protein L20 [Helianthus annuus] gb|OTG37577.1| putative ribosomal protein L20 [Helianthus annuus] gb|ASV47890.1| ribosomal protein L20 (chloroplast) [Ambrosia artemisiifolia] gb|AUJ22614.1| ribosomal protein L20 (chloroplast) [Ambrosia artemisiifolia] gb|AUJ22701.1| ribosomal protein L20 (chloroplast) [Ambrosia trifida] gb|AVN90094.1| ribosomal protein L20 (chloroplast) [Helianthus tuberosus] Length = 126 Score = 172 bits (435), Expect = 8e-52 Identities = 87/88 (98%), Positives = 87/88 (98%) Frame = -1 Query: 265 LFASSFRGAHSRLTRTITQQKIRALVSAHRDRDRQKINFRRLWITRINAAIRERGVCYSY 86 LFASSFRGAHSRLTRTITQQKIRALVSAHRDRDRQKINFRRLWITRINAAIRERGVCYSY Sbjct: 19 LFASSFRGAHSRLTRTITQQKIRALVSAHRDRDRQKINFRRLWITRINAAIRERGVCYSY 78 Query: 85 SRLINDLYKRQLLLNRKILAQIAISNRN 2 SR INDLYKRQLLLNRKILAQIAISNRN Sbjct: 79 SRFINDLYKRQLLLNRKILAQIAISNRN 106 >ref|YP_009447389.1| ribosomal protein L20 (chloroplast) [Achyrachaena mollis] gb|ATY69714.1| ribosomal protein L20 (chloroplast) [Achyrachaena mollis] Length = 126 Score = 171 bits (434), Expect = 1e-51 Identities = 86/88 (97%), Positives = 88/88 (100%) Frame = -1 Query: 265 LFASSFRGAHSRLTRTITQQKIRALVSAHRDRDRQKINFRRLWITRINAAIRERGVCYSY 86 LFASSFRGAHSRLTRTITQQKIRALVSAHRDRDRQKINFRRLWITRINAAIRERGVCYSY Sbjct: 19 LFASSFRGAHSRLTRTITQQKIRALVSAHRDRDRQKINFRRLWITRINAAIRERGVCYSY 78 Query: 85 SRLINDLYKRQLLLNRKILAQIAISNRN 2 SRLINDLYK+QL+LNRKILAQIAISNRN Sbjct: 79 SRLINDLYKKQLILNRKILAQIAISNRN 106 >gb|AJE73436.1| ribosomal protein L20 (plastid) [Antennaria howellii] gb|AJE73816.1| ribosomal protein L20 (plastid) [Antennaria neglecta] Length = 126 Score = 171 bits (434), Expect = 1e-51 Identities = 86/88 (97%), Positives = 88/88 (100%) Frame = -1 Query: 265 LFASSFRGAHSRLTRTITQQKIRALVSAHRDRDRQKINFRRLWITRINAAIRERGVCYSY 86 LFASSFRGAHSRLTRTITQQKIRALVSAHRDRD+QKINFRRLWITRINAAIRERGVCYSY Sbjct: 19 LFASSFRGAHSRLTRTITQQKIRALVSAHRDRDKQKINFRRLWITRINAAIRERGVCYSY 78 Query: 85 SRLINDLYKRQLLLNRKILAQIAISNRN 2 SRLINDLYKRQL+LNRKILAQIAISNRN Sbjct: 79 SRLINDLYKRQLILNRKILAQIAISNRN 106