BLASTX nr result
ID: Chrysanthemum22_contig00017225
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00017225 (481 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023740080.1| ABC transporter C family member 3-like isofo... 96 5e-20 ref|XP_023740081.1| ABC transporter C family member 3-like isofo... 96 5e-20 ref|XP_023740079.1| ABC transporter C family member 3-like isofo... 95 1e-19 gb|PLY69044.1| hypothetical protein LSAT_9X91061 [Lactuca sativa] 93 6e-19 >ref|XP_023740080.1| ABC transporter C family member 3-like isoform X2 [Lactuca sativa] Length = 1483 Score = 96.3 bits (238), Expect = 5e-20 Identities = 43/72 (59%), Positives = 56/72 (77%) Frame = +2 Query: 266 GINIKFLPLLNLLTGDVSNFHQTPRLLHGFSESIYLGFLLLVFVTWLNRNFRSNSNGVPK 445 GI +KF PL ++LT D +N TPRLLHG+S S+YLGF +L+F+TW R FR+NSNG PK Sbjct: 2 GIAVKFSPLSSILTDDATNIPLTPRLLHGYSRSLYLGFFILLFITWFGRKFRNNSNGGPK 61 Query: 446 QIVRSNSGALCY 481 QI+RSN+ +L Y Sbjct: 62 QILRSNNRSLFY 73 >ref|XP_023740081.1| ABC transporter C family member 3-like isoform X3 [Lactuca sativa] Length = 1499 Score = 96.3 bits (238), Expect = 5e-20 Identities = 43/72 (59%), Positives = 56/72 (77%) Frame = +2 Query: 266 GINIKFLPLLNLLTGDVSNFHQTPRLLHGFSESIYLGFLLLVFVTWLNRNFRSNSNGVPK 445 GI +KF PL ++LT D +N TPRLLHG+S S+YLGF +L+F+TW R FR+NSNG PK Sbjct: 2 GIAVKFSPLSSILTDDATNIPLTPRLLHGYSRSLYLGFFILLFITWFGRKFRNNSNGGPK 61 Query: 446 QIVRSNSGALCY 481 QI+RSN+ +L Y Sbjct: 62 QILRSNNRSLFY 73 >ref|XP_023740079.1| ABC transporter C family member 3-like isoform X1 [Lactuca sativa] Length = 1502 Score = 95.1 bits (235), Expect = 1e-19 Identities = 44/72 (61%), Positives = 55/72 (76%) Frame = +2 Query: 266 GINIKFLPLLNLLTGDVSNFHQTPRLLHGFSESIYLGFLLLVFVTWLNRNFRSNSNGVPK 445 GI KF PL ++LT D SN TPRLLHG+S S+YLGF +L+F+TWL R FR+NSNG PK Sbjct: 2 GIAAKFSPLSSILTDDASNIPLTPRLLHGYSGSLYLGFFILLFITWLGRKFRNNSNGGPK 61 Query: 446 QIVRSNSGALCY 481 QI+RSN+ + Y Sbjct: 62 QILRSNNRSFFY 73 >gb|PLY69044.1| hypothetical protein LSAT_9X91061 [Lactuca sativa] Length = 1864 Score = 93.2 bits (230), Expect = 6e-19 Identities = 41/67 (61%), Positives = 53/67 (79%) Frame = +2 Query: 266 GINIKFLPLLNLLTGDVSNFHQTPRLLHGFSESIYLGFLLLVFVTWLNRNFRSNSNGVPK 445 GI +KF PL ++LT D +N TPRLLHG+S S+YLGF +L+F+TW R FR+NSNG PK Sbjct: 2 GIAVKFSPLSSILTDDATNIPLTPRLLHGYSRSLYLGFFILLFITWFGRKFRNNSNGGPK 61 Query: 446 QIVRSNS 466 QI+RSN+ Sbjct: 62 QILRSNN 68