BLASTX nr result
ID: Chrysanthemum22_contig00017190
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00017190 (408 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKI66529.1| hypothetical protein CRG98_013093 [Punica granatum] 59 3e-07 >gb|PKI66529.1| hypothetical protein CRG98_013093 [Punica granatum] Length = 719 Score = 58.5 bits (140), Expect = 3e-07 Identities = 39/119 (32%), Positives = 62/119 (52%), Gaps = 3/119 (2%) Frame = -3 Query: 406 LPDYYDVIKRPMEFATM*KKLAKGL*ITLKESEF---SLLFHLRVV*RAYYKCLSA*NKQ 236 LPDY+D+I+ PM+F T+ KKLA G L++ E S+++ L++ AY+ + Sbjct: 194 LPDYHDIIEHPMDFGTVRKKLASGDYAKLEQFEDVFPSIVYCLQLFPSAYWWAET----- 248 Query: 235 IYRLIKTSKTSHLL*CYMCLRHAVFLMQSDVLLKCINAMQYNAPDTK*HKQVQKYSCIA 59 C + ++ + ++SDV L C NAMQYNAPDT +Q + +A Sbjct: 249 ---------------CLVLCQNDRYAIKSDVFLICSNAMQYNAPDTVYFRQARSIQELA 292