BLASTX nr result
ID: Chrysanthemum22_contig00017030
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00017030 (386 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|OTG14181.1| putative pentatricopeptide repeat protein [Helian... 135 1e-37 ref|XP_023747105.1| pentatricopeptide repeat-containing protein ... 137 4e-35 gb|PLY63744.1| hypothetical protein LSAT_9X67461 [Lactuca sativa] 137 4e-35 ref|XP_021981525.1| pentatricopeptide repeat-containing protein ... 135 2e-34 ref|XP_021981535.1| pentatricopeptide repeat-containing protein ... 129 4e-32 gb|KVI06902.1| Pentatricopeptide repeat-containing protein [Cyna... 129 4e-32 emb|CAN78081.1| hypothetical protein VITISV_021300 [Vitis vinifera] 91 8e-19 ref|XP_010658442.1| PREDICTED: pentatricopeptide repeat-containi... 89 4e-18 ref|XP_010272603.1| PREDICTED: pentatricopeptide repeat-containi... 86 7e-17 ref|XP_022942538.1| pentatricopeptide repeat-containing protein ... 85 2e-16 ref|XP_022983777.1| pentatricopeptide repeat-containing protein ... 84 2e-16 ref|XP_023525433.1| pentatricopeptide repeat-containing protein ... 84 4e-16 ref|XP_010315377.1| PREDICTED: pentatricopeptide repeat-containi... 83 8e-16 ref|XP_017226914.1| PREDICTED: pentatricopeptide repeat-containi... 82 1e-15 ref|XP_021897792.1| pentatricopeptide repeat-containing protein ... 81 3e-15 ref|XP_015062860.1| PREDICTED: pentatricopeptide repeat-containi... 81 4e-15 gb|PIA44164.1| hypothetical protein AQUCO_01700049v1 [Aquilegia ... 81 4e-15 ref|XP_023929785.1| pentatricopeptide repeat-containing protein ... 80 7e-15 gb|POE89042.1| pentatricopeptide repeat-containing protein [Quer... 80 7e-15 ref|XP_018828718.1| PREDICTED: pentatricopeptide repeat-containi... 78 3e-14 >gb|OTG14181.1| putative pentatricopeptide repeat protein [Helianthus annuus] Length = 189 Score = 135 bits (340), Expect = 1e-37 Identities = 74/125 (59%), Positives = 89/125 (71%), Gaps = 4/125 (3%) Frame = +2 Query: 23 MTSSSSPNGS----QEMTETLTEILTKTQKFNSIKPTITNYLPQLTPKTIQTIISSKPLK 190 MTSSS PN +TETLT IL+ T N +I+ ++P LTP I +II SK LK Sbjct: 1 MTSSSPPNPPPATPSSLTETLTLILSNTTN-NPTTSSISQFIPYLTPTVIHSIIQSKTLK 59 Query: 191 SNPNTLLNFFKFTQTNTPNFKIGSLTTLPSFFIVLQTLFAHNKFPDAKNLLLDFIRADTR 370 S+P LL+FFKF+ + PNF IGS TTLPSFF +LQTLFAHNK+ DAK LL+DFI ADTR Sbjct: 60 SHPQILLHFFKFSLIHAPNFSIGSPTTLPSFFTLLQTLFAHNKYSDAKTLLVDFIAADTR 119 Query: 371 RLLLK 385 RLLL+ Sbjct: 120 RLLLR 124 >ref|XP_023747105.1| pentatricopeptide repeat-containing protein At2g16880 [Lactuca sativa] Length = 772 Score = 137 bits (346), Expect = 4e-35 Identities = 75/126 (59%), Positives = 88/126 (69%), Gaps = 3/126 (2%) Frame = +2 Query: 17 LMMTSSSSPN---GSQEMTETLTEILTKTQKFNSIKPTITNYLPQLTPKTIQTIISSKPL 187 +M TSSS P E+TETLT+IL S+ +I+ ++P LTP I TIISSK L Sbjct: 1 MMNTSSSPPKPPLNPSEITETLTKILATNTPSTSLTSSISEFIPYLTPGIIHTIISSKTL 60 Query: 188 KSNPNTLLNFFKFTQTNTPNFKIGSLTTLPSFFIVLQTLFAHNKFPDAKNLLLDFIRADT 367 KSNP LLNFFK +QT+ PNF GS TTLPS F+VLQTLFAHNK+ DAK LLL FI ADT Sbjct: 61 KSNPQALLNFFKISQTHAPNFVNGSPTTLPSLFVVLQTLFAHNKWSDAKALLLSFIGADT 120 Query: 368 RRLLLK 385 R LL+ Sbjct: 121 RHRLLR 126 >gb|PLY63744.1| hypothetical protein LSAT_9X67461 [Lactuca sativa] Length = 790 Score = 137 bits (346), Expect = 4e-35 Identities = 75/126 (59%), Positives = 88/126 (69%), Gaps = 3/126 (2%) Frame = +2 Query: 17 LMMTSSSSPN---GSQEMTETLTEILTKTQKFNSIKPTITNYLPQLTPKTIQTIISSKPL 187 +M TSSS P E+TETLT+IL S+ +I+ ++P LTP I TIISSK L Sbjct: 1 MMNTSSSPPKPPLNPSEITETLTKILATNTPSTSLTSSISEFIPYLTPGIIHTIISSKTL 60 Query: 188 KSNPNTLLNFFKFTQTNTPNFKIGSLTTLPSFFIVLQTLFAHNKFPDAKNLLLDFIRADT 367 KSNP LLNFFK +QT+ PNF GS TTLPS F+VLQTLFAHNK+ DAK LLL FI ADT Sbjct: 61 KSNPQALLNFFKISQTHAPNFVNGSPTTLPSLFVVLQTLFAHNKWSDAKALLLSFIGADT 120 Query: 368 RRLLLK 385 R LL+ Sbjct: 121 RHRLLR 126 >ref|XP_021981525.1| pentatricopeptide repeat-containing protein At2g16880-like [Helianthus annuus] Length = 772 Score = 135 bits (340), Expect = 2e-34 Identities = 74/125 (59%), Positives = 89/125 (71%), Gaps = 4/125 (3%) Frame = +2 Query: 23 MTSSSSPNGS----QEMTETLTEILTKTQKFNSIKPTITNYLPQLTPKTIQTIISSKPLK 190 MTSSS PN +TETLT IL+ T N +I+ ++P LTP I +II SK LK Sbjct: 1 MTSSSPPNPPPATPSSLTETLTLILSNTTN-NPTTSSISQFIPYLTPTVIHSIIQSKTLK 59 Query: 191 SNPNTLLNFFKFTQTNTPNFKIGSLTTLPSFFIVLQTLFAHNKFPDAKNLLLDFIRADTR 370 S+P LL+FFKF+ + PNF IGS TTLPSFF +LQTLFAHNK+ DAK LL+DFI ADTR Sbjct: 60 SHPQILLHFFKFSLIHAPNFSIGSPTTLPSFFTLLQTLFAHNKYSDAKTLLVDFIAADTR 119 Query: 371 RLLLK 385 RLLL+ Sbjct: 120 RLLLR 124 >ref|XP_021981535.1| pentatricopeptide repeat-containing protein At2g16880-like [Helianthus annuus] ref|XP_021981536.1| pentatricopeptide repeat-containing protein At2g16880-like [Helianthus annuus] ref|XP_021981537.1| pentatricopeptide repeat-containing protein At2g16880-like [Helianthus annuus] ref|XP_021981538.1| pentatricopeptide repeat-containing protein At2g16880-like [Helianthus annuus] ref|XP_021981539.1| pentatricopeptide repeat-containing protein At2g16880-like [Helianthus annuus] ref|XP_021981541.1| pentatricopeptide repeat-containing protein At2g16880-like [Helianthus annuus] ref|XP_021981542.1| pentatricopeptide repeat-containing protein At2g16880-like [Helianthus annuus] gb|OTG14186.1| putative pentatricopeptide repeat (PPR) superfamily protein [Helianthus annuus] Length = 777 Score = 129 bits (324), Expect = 4e-32 Identities = 71/125 (56%), Positives = 88/125 (70%), Gaps = 5/125 (4%) Frame = +2 Query: 26 TSSSSPNGSQ-----EMTETLTEILTKTQKFNSIKPTITNYLPQLTPKTIQTIISSKPLK 190 TSSSSP + +TETLT IL+ T N +I+ ++P LTP I +II SK LK Sbjct: 6 TSSSSPPNTPPATPYSLTETLTLILSNTTN-NPTTSSISQFIPYLTPTVIHSIIQSKTLK 64 Query: 191 SNPNTLLNFFKFTQTNTPNFKIGSLTTLPSFFIVLQTLFAHNKFPDAKNLLLDFIRADTR 370 S+P LL+FF F+ + P+F IGS TTLPSFF +LQTLFAHNK+ DAK LL+DFI ADTR Sbjct: 65 SHPQILLHFFNFSLIHAPSFSIGSPTTLPSFFTLLQTLFAHNKYSDAKTLLVDFIAADTR 124 Query: 371 RLLLK 385 RLLL+ Sbjct: 125 RLLLR 129 >gb|KVI06902.1| Pentatricopeptide repeat-containing protein [Cynara cardunculus var. scolymus] Length = 638 Score = 129 bits (323), Expect = 4e-32 Identities = 68/127 (53%), Positives = 89/127 (70%), Gaps = 4/127 (3%) Frame = +2 Query: 17 LMMTSSSSPN----GSQEMTETLTEILTKTQKFNSIKPTITNYLPQLTPKTIQTIISSKP 184 +M T+SSSP E+T+ LT+IL K S+ +I+ ++P LTP I +++SS+ Sbjct: 1 MMNTTSSSPPKPPLNPSEITQNLTKILAKNPPSISLISSISKFIPHLTPVIIHSVVSSQT 60 Query: 185 LKSNPNTLLNFFKFTQTNTPNFKIGSLTTLPSFFIVLQTLFAHNKFPDAKNLLLDFIRAD 364 LKSNP LLNFFK +Q + P+F GS TLPSFF+VLQTLFAHNK+ DAK LLL+FI AD Sbjct: 61 LKSNPQILLNFFKISQLHAPSFSNGSPATLPSFFVVLQTLFAHNKWADAKTLLLNFIGAD 120 Query: 365 TRRLLLK 385 TR LL+ Sbjct: 121 TRHRLLR 127 >emb|CAN78081.1| hypothetical protein VITISV_021300 [Vitis vinifera] Length = 778 Score = 91.3 bits (225), Expect = 8e-19 Identities = 51/111 (45%), Positives = 67/111 (60%) Frame = +2 Query: 38 SPNGSQEMTETLTEILTKTQKFNSIKPTITNYLPQLTPKTIQTIISSKPLKSNPNTLLNF 217 +P QE+ +T+T IL N + Y+PQLTP + +I+SSK L S PN L++F Sbjct: 16 APLPPQELIQTITTILASN---NMPLQALNTYIPQLTPPLVLSILSSKTLISRPNILISF 72 Query: 218 FKFTQTNTPNFKIGSLTTLPSFFIVLQTLFAHNKFPDAKNLLLDFIRADTR 370 FK+ QTN P F S LPS +L +LF+H KF DAK+LLL FI D R Sbjct: 73 FKWAQTNLPTFPHNS---LPSLLSLLPSLFSHRKFSDAKSLLLGFIATDRR 120 >ref|XP_010658442.1| PREDICTED: pentatricopeptide repeat-containing protein At2g16880 [Vitis vinifera] ref|XP_010658443.1| PREDICTED: pentatricopeptide repeat-containing protein At2g16880 [Vitis vinifera] ref|XP_010658444.1| PREDICTED: pentatricopeptide repeat-containing protein At2g16880 [Vitis vinifera] ref|XP_019080170.1| PREDICTED: pentatricopeptide repeat-containing protein At2g16880 [Vitis vinifera] ref|XP_019080171.1| PREDICTED: pentatricopeptide repeat-containing protein At2g16880 [Vitis vinifera] Length = 778 Score = 89.4 bits (220), Expect = 4e-18 Identities = 50/111 (45%), Positives = 66/111 (59%) Frame = +2 Query: 38 SPNGSQEMTETLTEILTKTQKFNSIKPTITNYLPQLTPKTIQTIISSKPLKSNPNTLLNF 217 +P QE+ +T+T IL N + Y+P LTP + +I+SSK L S PN L++F Sbjct: 16 APLPPQELIQTITTILASN---NMPLQALNTYIPHLTPPLVLSILSSKTLISRPNILISF 72 Query: 218 FKFTQTNTPNFKIGSLTTLPSFFIVLQTLFAHNKFPDAKNLLLDFIRADTR 370 FK+ QTN P F S LPS +L +LF+H KF DAK+LLL FI D R Sbjct: 73 FKWAQTNLPTFPHNS---LPSLLSLLPSLFSHRKFSDAKSLLLGFIATDRR 120 >ref|XP_010272603.1| PREDICTED: pentatricopeptide repeat-containing protein At2g16880 [Nelumbo nucifera] ref|XP_010272610.1| PREDICTED: pentatricopeptide repeat-containing protein At2g16880 [Nelumbo nucifera] ref|XP_019055179.1| PREDICTED: pentatricopeptide repeat-containing protein At2g16880 [Nelumbo nucifera] Length = 791 Score = 85.9 bits (211), Expect = 7e-17 Identities = 51/110 (46%), Positives = 68/110 (61%), Gaps = 1/110 (0%) Frame = +2 Query: 38 SPNGSQEMTETLTEILTKTQ-KFNSIKPTITNYLPQLTPKTIQTIISSKPLKSNPNTLLN 214 SP E+ E +T ILT +Q S+ P Y+P LTP I +I+SS L S P+TLL+ Sbjct: 13 SPPTESEVIENVTNILTSSQASLQSLYP----YIPHLTPSLISSILSSASLYSRPSTLLS 68 Query: 215 FFKFTQTNTPNFKIGSLTTLPSFFIVLQTLFAHNKFPDAKNLLLDFIRAD 364 FFK+ ++ PNF S +L S +L +LF HNKF DAK+LLL FI +D Sbjct: 69 FFKWCHSHIPNFSHQS-NSLHSLLKLLPSLFHHNKFSDAKSLLLSFIASD 117 >ref|XP_022942538.1| pentatricopeptide repeat-containing protein At2g16880 [Cucurbita moschata] ref|XP_022942539.1| pentatricopeptide repeat-containing protein At2g16880 [Cucurbita moschata] ref|XP_022942540.1| pentatricopeptide repeat-containing protein At2g16880 [Cucurbita moschata] ref|XP_022942542.1| pentatricopeptide repeat-containing protein At2g16880 [Cucurbita moschata] Length = 777 Score = 84.7 bits (208), Expect = 2e-16 Identities = 49/123 (39%), Positives = 71/123 (57%), Gaps = 1/123 (0%) Frame = +2 Query: 20 MMTSSSSPNGSQEMTETLTEILTKTQK-FNSIKPTITNYLPQLTPKTIQTIISSKPLKSN 196 M T S S E+ +T+T ILT T+ ++ P Y L+P + +I+SSK L S+ Sbjct: 1 METPSISNQRPSELIQTITTILTSTKAPLTALAP----YAAHLSPSLVSSILSSKALSSH 56 Query: 197 PNTLLNFFKFTQTNTPNFKIGSLTTLPSFFIVLQTLFAHNKFPDAKNLLLDFIRADTRRL 376 P LL+ FK+ Q + P+F +L S F +L +LF+HNKF DAK+LL+ FI D + Sbjct: 57 PTILLSLFKWAQKHVPSFSSPPNNSLSSLFTILPSLFSHNKFSDAKSLLVSFIANDRQHE 116 Query: 377 LLK 385 L K Sbjct: 117 LHK 119 >ref|XP_022983777.1| pentatricopeptide repeat-containing protein At2g16880 [Cucurbita maxima] ref|XP_022983785.1| pentatricopeptide repeat-containing protein At2g16880 [Cucurbita maxima] ref|XP_022983794.1| pentatricopeptide repeat-containing protein At2g16880 [Cucurbita maxima] ref|XP_022983803.1| pentatricopeptide repeat-containing protein At2g16880 [Cucurbita maxima] ref|XP_022983811.1| pentatricopeptide repeat-containing protein At2g16880 [Cucurbita maxima] Length = 777 Score = 84.3 bits (207), Expect = 2e-16 Identities = 49/123 (39%), Positives = 71/123 (57%), Gaps = 1/123 (0%) Frame = +2 Query: 20 MMTSSSSPNGSQEMTETLTEILTKTQK-FNSIKPTITNYLPQLTPKTIQTIISSKPLKSN 196 M T S S E+ +T+T ILT T+ ++ P Y L+P + +I+SSK L S+ Sbjct: 1 METPSISNQRPPELIQTITTILTSTKAPLTALAP----YAAHLSPSLVSSILSSKALSSH 56 Query: 197 PNTLLNFFKFTQTNTPNFKIGSLTTLPSFFIVLQTLFAHNKFPDAKNLLLDFIRADTRRL 376 P LL+ FK+ Q + P+F +L S F +L +LF+HNKF DAK+LL+ FI D + Sbjct: 57 PTILLSLFKWAQKHVPSFSSPPNNSLSSLFTILPSLFSHNKFSDAKSLLVSFIADDRQHE 116 Query: 377 LLK 385 L K Sbjct: 117 LHK 119 >ref|XP_023525433.1| pentatricopeptide repeat-containing protein At2g16880 [Cucurbita pepo subsp. pepo] ref|XP_023525440.1| pentatricopeptide repeat-containing protein At2g16880 [Cucurbita pepo subsp. pepo] ref|XP_023525450.1| pentatricopeptide repeat-containing protein At2g16880 [Cucurbita pepo subsp. pepo] ref|XP_023525458.1| pentatricopeptide repeat-containing protein At2g16880 [Cucurbita pepo subsp. pepo] Length = 777 Score = 83.6 bits (205), Expect = 4e-16 Identities = 48/123 (39%), Positives = 71/123 (57%), Gaps = 1/123 (0%) Frame = +2 Query: 20 MMTSSSSPNGSQEMTETLTEILTKTQK-FNSIKPTITNYLPQLTPKTIQTIISSKPLKSN 196 M T S + E+ +T+T ILT T+ ++ P Y L+P + +I+SSK L S+ Sbjct: 1 METPSITNQRPSELIQTITTILTSTKAPLTALAP----YAAHLSPSLVSSILSSKALSSH 56 Query: 197 PNTLLNFFKFTQTNTPNFKIGSLTTLPSFFIVLQTLFAHNKFPDAKNLLLDFIRADTRRL 376 P LL+ FK+ Q + P+F +L S F +L +LF+HNKF DAK+LL+ FI D + Sbjct: 57 PTILLSLFKWAQKHVPSFSSPPNNSLSSLFTILPSLFSHNKFSDAKSLLVSFIANDRQHE 116 Query: 377 LLK 385 L K Sbjct: 117 LHK 119 >ref|XP_010315377.1| PREDICTED: pentatricopeptide repeat-containing protein At2g16880 [Solanum lycopersicum] ref|XP_010315378.1| PREDICTED: pentatricopeptide repeat-containing protein At2g16880 [Solanum lycopersicum] ref|XP_019067483.1| PREDICTED: pentatricopeptide repeat-containing protein At2g16880 [Solanum lycopersicum] ref|XP_019067484.1| PREDICTED: pentatricopeptide repeat-containing protein At2g16880 [Solanum lycopersicum] ref|XP_019067485.1| PREDICTED: pentatricopeptide repeat-containing protein At2g16880 [Solanum lycopersicum] Length = 770 Score = 82.8 bits (203), Expect = 8e-16 Identities = 46/120 (38%), Positives = 76/120 (63%) Frame = +2 Query: 23 MTSSSSPNGSQEMTETLTEILTKTQKFNSIKPTITNYLPQLTPKTIQTIISSKPLKSNPN 202 M+SS P ++ +T+T +L+ + K + K ++ +YLP LTP I +I+SS PL S P+ Sbjct: 1 MSSSYPPLKPSQLVQTITTLLSSSPK-SLPKCSLQSYLPHLTPPIIHSILSSPPLSSRPS 59 Query: 203 TLLNFFKFTQTNTPNFKIGSLTTLPSFFIVLQTLFAHNKFPDAKNLLLDFIRADTRRLLL 382 TL +FF+++Q++ P+F L PS +L +L +H +F A++LLL FI +D + LL Sbjct: 60 TLFSFFQWSQSHIPSFSTHPL-PFPSLLPILSSLLSHRRFTVARSLLLTFIPSDHPQHLL 118 >ref|XP_017226914.1| PREDICTED: pentatricopeptide repeat-containing protein At2g16880 [Daucus carota subsp. sativus] ref|XP_017226995.1| PREDICTED: pentatricopeptide repeat-containing protein At2g16880 [Daucus carota subsp. sativus] gb|KZN08883.1| hypothetical protein DCAR_001539 [Daucus carota subsp. sativus] Length = 763 Score = 82.0 bits (201), Expect = 1e-15 Identities = 49/121 (40%), Positives = 72/121 (59%), Gaps = 1/121 (0%) Frame = +2 Query: 20 MMTSSSSPNGSQEMTETLTEILTKTQKFNSIKPTITNYLPQLTPKTIQTIISSKPLKSNP 199 M SSS + +T TLT ++ ++ +++ ++P LTP I +++SSK L S P Sbjct: 1 MKLSSSETELMRNITATLT-----SKAISNPHESLSQFIPHLTPPIILSLLSSKTLSSRP 55 Query: 200 NTLLNFFKFTQTNTPNFKIGSLTTLPSFFI-VLQTLFAHNKFPDAKNLLLDFIRADTRRL 376 NTLL+ +KFT N P+ S T SF + +L LF+HNKF DAK LL+D+I DT+ Sbjct: 56 NTLLSLYKFTLNNAPHL---SPPTRTSFLLTLLPPLFSHNKFSDAKRLLVDYISQDTKHH 112 Query: 377 L 379 L Sbjct: 113 L 113 >ref|XP_021897792.1| pentatricopeptide repeat-containing protein At2g16880 [Carica papaya] Length = 672 Score = 81.3 bits (199), Expect = 3e-15 Identities = 46/111 (41%), Positives = 70/111 (63%) Frame = +2 Query: 35 SSPNGSQEMTETLTEILTKTQKFNSIKPTITNYLPQLTPKTIQTIISSKPLKSNPNTLLN 214 SS ++ +TLT ILT + + +T Y+PQ++ + +++SS L S PNTLL+ Sbjct: 3 SSAQSEAQLLKTLTAILTSEKM--PLMEGLTQYIPQISQSLLLSLLSSPSLSSRPNTLLS 60 Query: 215 FFKFTQTNTPNFKIGSLTTLPSFFIVLQTLFAHNKFPDAKNLLLDFIRADT 367 FF + Q++ P+F S + LP + VL L +HNKF DAK+LLL FIR+D+ Sbjct: 61 FFNWAQSSLPSFP--SDSPLPLLY-VLPPLLSHNKFSDAKSLLLSFIRSDS 108 >ref|XP_015062860.1| PREDICTED: pentatricopeptide repeat-containing protein At2g16880 [Solanum pennellii] Length = 770 Score = 80.9 bits (198), Expect = 4e-15 Identities = 45/120 (37%), Positives = 75/120 (62%) Frame = +2 Query: 23 MTSSSSPNGSQEMTETLTEILTKTQKFNSIKPTITNYLPQLTPKTIQTIISSKPLKSNPN 202 M+SS P ++ +T+T +L+ + K + K ++ +YLP LTP I +I+SS L S P+ Sbjct: 1 MSSSYPPLKPSQLVQTITTLLSSSPK-SLPKSSLQSYLPHLTPPIIHSILSSSTLSSRPS 59 Query: 203 TLLNFFKFTQTNTPNFKIGSLTTLPSFFIVLQTLFAHNKFPDAKNLLLDFIRADTRRLLL 382 TL +FF+++Q++ P+F L PS +L +L +H +F A++LLL FI +D + LL Sbjct: 60 TLFSFFQWSQSHIPSFSTQPL-PFPSLLPILSSLLSHRRFTVARSLLLTFIPSDHPQHLL 118 >gb|PIA44164.1| hypothetical protein AQUCO_01700049v1 [Aquilegia coerulea] Length = 785 Score = 80.9 bits (198), Expect = 4e-15 Identities = 48/115 (41%), Positives = 68/115 (59%) Frame = +2 Query: 35 SSPNGSQEMTETLTEILTKTQKFNSIKPTITNYLPQLTPKTIQTIISSKPLKSNPNTLLN 214 SS ++ ET+T +L + NS + T+ +P L P I +IISS L ++PNTLL+ Sbjct: 3 SSTKTQSKIIETITHLLKSSP--NSFQ-TLVECIPHLNPSIIPSIISSSSLSTDPNTLLS 59 Query: 215 FFKFTQTNTPNFKIGSLTTLPSFFIVLQTLFAHNKFPDAKNLLLDFIRADTRRLL 379 F+K+ QT+ PNF S T+LPS +L L KF D K++LL FI D + LL Sbjct: 60 FYKWCQTHLPNFTNPS-TSLPSLLSLLPPLIRFKKFTDTKSILLSFIAQDDKHLL 113 >ref|XP_023929785.1| pentatricopeptide repeat-containing protein At2g16880-like [Quercus suber] ref|XP_023929786.1| pentatricopeptide repeat-containing protein At2g16880-like [Quercus suber] Length = 768 Score = 80.1 bits (196), Expect = 7e-15 Identities = 47/104 (45%), Positives = 68/104 (65%), Gaps = 1/104 (0%) Frame = +2 Query: 56 EMTETLTEILTKTQKFNSIKPTITNYLPQLTPKTIQTIISSKPLKSNPNTLLNFFKFTQT 235 ++ ET+T+ILT N+ T+T +LP LT +++SSK L S P+TLL+FFKF Q+ Sbjct: 8 QVLETITKILTTP---NTPLETLTPHLPNLTQPLFLSLLSSKTLSSRPSTLLSFFKFLQS 64 Query: 236 NTPNFKIGSLTTLP-SFFIVLQTLFAHNKFPDAKNLLLDFIRAD 364 ++P SLT+ P S +L +LF H KF DAK+LL+ FI +D Sbjct: 65 HSP-----SLTSSPHSLLSLLPSLFGHGKFSDAKSLLVSFIASD 103 >gb|POE89042.1| pentatricopeptide repeat-containing protein [Quercus suber] Length = 805 Score = 80.1 bits (196), Expect = 7e-15 Identities = 47/104 (45%), Positives = 68/104 (65%), Gaps = 1/104 (0%) Frame = +2 Query: 56 EMTETLTEILTKTQKFNSIKPTITNYLPQLTPKTIQTIISSKPLKSNPNTLLNFFKFTQT 235 ++ ET+T+ILT N+ T+T +LP LT +++SSK L S P+TLL+FFKF Q+ Sbjct: 8 QVLETITKILTTP---NTPLETLTPHLPNLTQPLFLSLLSSKTLSSRPSTLLSFFKFLQS 64 Query: 236 NTPNFKIGSLTTLP-SFFIVLQTLFAHNKFPDAKNLLLDFIRAD 364 ++P SLT+ P S +L +LF H KF DAK+LL+ FI +D Sbjct: 65 HSP-----SLTSSPHSLLSLLPSLFGHGKFSDAKSLLVSFIASD 103 >ref|XP_018828718.1| PREDICTED: pentatricopeptide repeat-containing protein At2g16880 [Juglans regia] ref|XP_018828719.1| PREDICTED: pentatricopeptide repeat-containing protein At2g16880 [Juglans regia] ref|XP_018828720.1| PREDICTED: pentatricopeptide repeat-containing protein At2g16880 [Juglans regia] ref|XP_018828721.1| PREDICTED: pentatricopeptide repeat-containing protein At2g16880 [Juglans regia] Length = 774 Score = 78.2 bits (191), Expect = 3e-14 Identities = 44/109 (40%), Positives = 72/109 (66%), Gaps = 1/109 (0%) Frame = +2 Query: 56 EMTETLTEILTKTQKFNSIKPTITNYLPQLTPKTIQTIISSKPLKSNPNTLLNFFKFTQT 235 ++ +T+ +ILT + N+ ++T YLP LT + +++SSK L S P TLL+FF+F Q+ Sbjct: 15 QLLQTIAQILTSS---NAPLHSLTPYLPHLTQPILLSLLSSKTLASRPYTLLSFFRFLQS 71 Query: 236 NTPNFKIGSLTTLPSFFI-VLQTLFAHNKFPDAKNLLLDFIRADTRRLL 379 ++P SLT P+ + +L +LF+H+KF DAK+LL+ FI +D + L Sbjct: 72 HSP-----SLTASPNCVLSILPSLFSHSKFSDAKSLLVSFITSDRQHQL 115