BLASTX nr result
ID: Chrysanthemum22_contig00016907
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00016907 (419 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAF79492.1|AC022492_36 F1L3.2 [Arabidopsis thaliana] 53 5e-06 ref|NP_849806.1| oligouridylate-binding protein 1A [Arabidopsis ... 53 7e-06 >gb|AAF79492.1|AC022492_36 F1L3.2 [Arabidopsis thaliana] Length = 575 Score = 53.1 bits (126), Expect(2) = 5e-06 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = +2 Query: 323 LLLICFRDAQVMLDQKTGRSRGFGFVSFRNQQ 418 + ++C RDA+VM DQKTGRSRGFGFVSFRNQQ Sbjct: 267 IAIVC-RDARVMWDQKTGRSRGFGFVSFRNQQ 297 Score = 24.6 bits (52), Expect(2) = 5e-06 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = +1 Query: 214 HFDIFVGDLSTRIFVCLL 267 HF+IFVGDLS + +L Sbjct: 231 HFNIFVGDLSPEVTDAML 248 >ref|NP_849806.1| oligouridylate-binding protein 1A [Arabidopsis thaliana] gb|AEE33044.1| oligouridylate-binding protein 1A [Arabidopsis thaliana] Length = 430 Score = 53.1 bits (126), Expect(2) = 7e-06 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = +2 Query: 338 FRDAQVMLDQKTGRSRGFGFVSFRNQQ 418 +RDA+VM DQKTGRSRGFGFVSFRNQQ Sbjct: 178 YRDARVMWDQKTGRSRGFGFVSFRNQQ 204 Score = 24.3 bits (51), Expect(2) = 7e-06 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = +1 Query: 214 HFDIFVGDLSTRI 252 HF+IFVGDLS + Sbjct: 147 HFNIFVGDLSPEV 159