BLASTX nr result
ID: Chrysanthemum22_contig00016895
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00016895 (390 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|OTG18522.1| putative myb domain, plant, Homeodomain-like prot... 51 5e-06 ref|XP_021614658.1| myb family transcription factor PHL6 isoform... 54 7e-06 ref|XP_021614657.1| myb family transcription factor PHL6 isoform... 54 7e-06 dbj|GAV90481.1| Myb_DNA-binding domain-containing protein/Myb_CC... 52 9e-06 gb|KHG11436.1| Myb family transcription factor APL [Gossypium ar... 54 1e-05 >gb|OTG18522.1| putative myb domain, plant, Homeodomain-like protein [Helianthus annuus] Length = 78 Score = 51.2 bits (121), Expect = 5e-06 Identities = 23/24 (95%), Positives = 24/24 (100%) Frame = -1 Query: 390 TPKGVLKLMNVEGLTIYHVKSHLQ 319 TPKGVLKLMNV+GLTIYHVKSHLQ Sbjct: 26 TPKGVLKLMNVDGLTIYHVKSHLQ 49 >ref|XP_021614658.1| myb family transcription factor PHL6 isoform X4 [Manihot esculenta] Length = 492 Score = 54.3 bits (129), Expect = 7e-06 Identities = 26/30 (86%), Positives = 26/30 (86%) Frame = -1 Query: 390 TPKGVLKLMNVEGLTIYHVKSHLQVRKKVY 301 TPKGVLKLMNVEGLTIYHVKSHLQ R Y Sbjct: 302 TPKGVLKLMNVEGLTIYHVKSHLQYRIAKY 331 >ref|XP_021614657.1| myb family transcription factor PHL6 isoform X3 [Manihot esculenta] Length = 493 Score = 54.3 bits (129), Expect = 7e-06 Identities = 26/30 (86%), Positives = 26/30 (86%) Frame = -1 Query: 390 TPKGVLKLMNVEGLTIYHVKSHLQVRKKVY 301 TPKGVLKLMNVEGLTIYHVKSHLQ R Y Sbjct: 303 TPKGVLKLMNVEGLTIYHVKSHLQYRIAKY 332 >dbj|GAV90481.1| Myb_DNA-binding domain-containing protein/Myb_CC_LHEQLE domain-containing protein [Cephalotus follicularis] Length = 154 Score = 52.4 bits (124), Expect = 9e-06 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -1 Query: 390 TPKGVLKLMNVEGLTIYHVKSHLQ 319 TPKGVLKLMNVEGLTIYHVKSHLQ Sbjct: 125 TPKGVLKLMNVEGLTIYHVKSHLQ 148 >gb|KHG11436.1| Myb family transcription factor APL [Gossypium arboreum] Length = 441 Score = 53.9 bits (128), Expect = 1e-05 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 390 TPKGVLKLMNVEGLTIYHVKSHLQV 316 TPKGVLKLMNVEGLTIYHVKSHLQV Sbjct: 257 TPKGVLKLMNVEGLTIYHVKSHLQV 281