BLASTX nr result
ID: Chrysanthemum22_contig00016873
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00016873 (384 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|OTF87677.1| putative F-box domain, Leucine-rich repeat domain... 77 5e-14 gb|OTF87675.1| putative F-box domain, Leucine-rich repeat domain... 77 5e-14 ref|XP_022024815.1| F-box/LRR-repeat protein At3g59200-like [Hel... 77 8e-14 ref|XP_022021971.1| FBD-associated F-box protein At4g10400-like ... 77 1e-13 ref|XP_022022838.1| FBD-associated F-box protein At4g10400-like ... 75 3e-13 gb|OTF87706.1| putative F-box/RNI-like superfamily protein [Heli... 75 4e-13 ref|XP_022022129.1| F-box/FBD/LRR-repeat protein At1g78750-like ... 75 5e-13 gb|OTF87679.1| putative F-box domain-containing protein [Heliant... 69 7e-13 ref|XP_022025890.1| putative F-box/FBD/LRR-repeat protein At4g13... 74 9e-13 ref|XP_022021785.1| putative F-box/FBD/LRR-repeat protein At1g78... 74 1e-12 ref|XP_022021784.1| putative F-box/FBD/LRR-repeat protein At1g78... 74 1e-12 gb|OTF87663.1| putative F-box domain, FBD domain, Leucine-rich r... 74 1e-12 gb|OTF87696.1| putative F-box domain, FBD domain, Leucine-rich r... 73 2e-12 ref|XP_022020700.1| F-box/LRR-repeat protein At3g59200-like [Hel... 73 2e-12 ref|XP_022022562.1| FBD-associated F-box protein At4g10400-like ... 73 2e-12 gb|OTF87705.1| putative FBD-associated F-box protein [Helianthus... 72 3e-12 ref|XP_022021952.1| putative F-box/FBD/LRR-repeat protein At5g22... 72 4e-12 ref|XP_022022071.1| F-box/LRR-repeat protein At4g14103-like [Hel... 72 4e-12 ref|XP_022021120.1| F-box/LRR-repeat protein At4g14103-like [Hel... 72 6e-12 ref|XP_022021782.1| F-box/LRR-repeat protein At3g59200-like isof... 71 7e-12 >gb|OTF87677.1| putative F-box domain, Leucine-rich repeat domain, L domain-like protein [Helianthus annuus] Length = 298 Score = 76.6 bits (187), Expect = 5e-14 Identities = 36/47 (76%), Positives = 42/47 (89%) Frame = +1 Query: 241 MTSTGEHVVDRLSSLPQDVLSDILSLMPTKFAVRTSLLSKRWRYTWT 381 M+ST E+V DRLS LP+D+LS ILSLMPTK+AV TS+LSKRWRYTWT Sbjct: 1 MSSTSENVDDRLSMLPEDILSRILSLMPTKYAVGTSVLSKRWRYTWT 47 >gb|OTF87675.1| putative F-box domain, Leucine-rich repeat domain, L domain-like protein [Helianthus annuus] Length = 298 Score = 76.6 bits (187), Expect = 5e-14 Identities = 36/47 (76%), Positives = 42/47 (89%) Frame = +1 Query: 241 MTSTGEHVVDRLSSLPQDVLSDILSLMPTKFAVRTSLLSKRWRYTWT 381 M+ST E+V DRLS LP+D+LS ILSLMPTK+AV TS+LSKRWRYTWT Sbjct: 1 MSSTSENVDDRLSMLPEDILSRILSLMPTKYAVGTSVLSKRWRYTWT 47 >ref|XP_022024815.1| F-box/LRR-repeat protein At3g59200-like [Helianthus annuus] Length = 376 Score = 76.6 bits (187), Expect = 8e-14 Identities = 36/47 (76%), Positives = 42/47 (89%) Frame = +1 Query: 241 MTSTGEHVVDRLSSLPQDVLSDILSLMPTKFAVRTSLLSKRWRYTWT 381 M+ST E+V DRLS LP+D+LS ILSLMPTK+AV TS+LSKRWRYTWT Sbjct: 1 MSSTSENVDDRLSMLPEDILSRILSLMPTKYAVGTSVLSKRWRYTWT 47 >ref|XP_022021971.1| FBD-associated F-box protein At4g10400-like [Helianthus annuus] Length = 461 Score = 76.6 bits (187), Expect = 1e-13 Identities = 36/47 (76%), Positives = 42/47 (89%) Frame = +1 Query: 241 MTSTGEHVVDRLSSLPQDVLSDILSLMPTKFAVRTSLLSKRWRYTWT 381 M+ST E+V DRLS LP+D+LS ILSLMPTK+AV TS+LSKRWRYTWT Sbjct: 1 MSSTSENVDDRLSMLPEDILSRILSLMPTKYAVGTSVLSKRWRYTWT 47 >ref|XP_022022838.1| FBD-associated F-box protein At4g10400-like [Helianthus annuus] gb|OTF87671.1| putative FBD, F-box and Leucine Rich Repeat domains containing protein [Helianthus annuus] Length = 334 Score = 74.7 bits (182), Expect = 3e-13 Identities = 34/47 (72%), Positives = 42/47 (89%) Frame = +1 Query: 241 MTSTGEHVVDRLSSLPQDVLSDILSLMPTKFAVRTSLLSKRWRYTWT 381 M+S E+V DRLS LP+D+L+ ILSLMPTK+AV+TS+LSKRWRYTWT Sbjct: 1 MSSISENVDDRLSMLPEDILARILSLMPTKYAVQTSILSKRWRYTWT 47 >gb|OTF87706.1| putative F-box/RNI-like superfamily protein [Helianthus annuus] Length = 357 Score = 74.7 bits (182), Expect = 4e-13 Identities = 34/47 (72%), Positives = 41/47 (87%) Frame = +1 Query: 238 EMTSTGEHVVDRLSSLPQDVLSDILSLMPTKFAVRTSLLSKRWRYTW 378 +M+S GE V DRLS LP+D +S ILSLMPTKFAVRTS+L+KRWRY+W Sbjct: 7 KMSSIGEDVDDRLSGLPEDTISHILSLMPTKFAVRTSILAKRWRYSW 53 >ref|XP_022022129.1| F-box/FBD/LRR-repeat protein At1g78750-like [Helianthus annuus] Length = 424 Score = 74.7 bits (182), Expect = 5e-13 Identities = 34/47 (72%), Positives = 41/47 (87%) Frame = +1 Query: 238 EMTSTGEHVVDRLSSLPQDVLSDILSLMPTKFAVRTSLLSKRWRYTW 378 +M+S GE V DRLS LP+D +S ILSLMPTKFAVRTS+L+KRWRY+W Sbjct: 7 KMSSIGEDVDDRLSGLPEDTISHILSLMPTKFAVRTSILAKRWRYSW 53 >gb|OTF87679.1| putative F-box domain-containing protein [Helianthus annuus] Length = 95 Score = 69.3 bits (168), Expect = 7e-13 Identities = 31/46 (67%), Positives = 40/46 (86%) Frame = +1 Query: 241 MTSTGEHVVDRLSSLPQDVLSDILSLMPTKFAVRTSLLSKRWRYTW 378 M+S GE+V D LS LP++++S ILSLMPTK+AVRTS+LSK+WRY W Sbjct: 1 MSSIGENVDDLLSMLPEEIVSHILSLMPTKYAVRTSVLSKKWRYVW 46 >ref|XP_022025890.1| putative F-box/FBD/LRR-repeat protein At4g13965 [Helianthus annuus] gb|OTF87690.1| putative F-box/FBD/LRR protein [Helianthus annuus] Length = 428 Score = 73.9 bits (180), Expect = 9e-13 Identities = 34/46 (73%), Positives = 41/46 (89%) Frame = +1 Query: 241 MTSTGEHVVDRLSSLPQDVLSDILSLMPTKFAVRTSLLSKRWRYTW 378 M+S E+V DRLS LP+D+LS ILSLMPTK+AVRTS+LSKRWRY+W Sbjct: 1 MSSISENVDDRLSRLPEDILSHILSLMPTKYAVRTSVLSKRWRYSW 46 >ref|XP_022021785.1| putative F-box/FBD/LRR-repeat protein At1g78760 isoform X2 [Helianthus annuus] Length = 449 Score = 73.6 bits (179), Expect = 1e-12 Identities = 35/47 (74%), Positives = 41/47 (87%) Frame = +1 Query: 241 MTSTGEHVVDRLSSLPQDVLSDILSLMPTKFAVRTSLLSKRWRYTWT 381 M+S+ E+V D LS LP+D+LS ILSLMPTK AVRTS+LSKRWRYTWT Sbjct: 1 MSSSTENVDDMLSMLPEDILSRILSLMPTKLAVRTSVLSKRWRYTWT 47 >ref|XP_022021784.1| putative F-box/FBD/LRR-repeat protein At1g78760 isoform X1 [Helianthus annuus] Length = 451 Score = 73.6 bits (179), Expect = 1e-12 Identities = 35/47 (74%), Positives = 41/47 (87%) Frame = +1 Query: 241 MTSTGEHVVDRLSSLPQDVLSDILSLMPTKFAVRTSLLSKRWRYTWT 381 M+S+ E+V D LS LP+D+LS ILSLMPTK AVRTS+LSKRWRYTWT Sbjct: 1 MSSSTENVDDMLSMLPEDILSRILSLMPTKLAVRTSVLSKRWRYTWT 47 >gb|OTF87663.1| putative F-box domain, FBD domain, Leucine-rich repeat domain, L domain-like protein [Helianthus annuus] Length = 555 Score = 73.6 bits (179), Expect = 1e-12 Identities = 35/47 (74%), Positives = 41/47 (87%) Frame = +1 Query: 241 MTSTGEHVVDRLSSLPQDVLSDILSLMPTKFAVRTSLLSKRWRYTWT 381 M+S+ E+V D LS LP+D+LS ILSLMPTK AVRTS+LSKRWRYTWT Sbjct: 105 MSSSTENVDDMLSMLPEDILSRILSLMPTKLAVRTSVLSKRWRYTWT 151 >gb|OTF87696.1| putative F-box domain, FBD domain, Leucine-rich repeat domain, L domain-like protein [Helianthus annuus] Length = 449 Score = 73.2 bits (178), Expect = 2e-12 Identities = 33/58 (56%), Positives = 45/58 (77%) Frame = +1 Query: 205 RRHLKDMIQVKEMTSTGEHVVDRLSSLPQDVLSDILSLMPTKFAVRTSLLSKRWRYTW 378 + + ++ +M+ST E+V DRLS LP+++LS ILSLMP KFAV+TS+LSKRWRY W Sbjct: 5 KNSINQQVKSLKMSSTSENVDDRLSMLPEEILSHILSLMPMKFAVQTSILSKRWRYIW 62 >ref|XP_022020700.1| F-box/LRR-repeat protein At3g59200-like [Helianthus annuus] gb|OTF87726.1| putative F-box/RNI-like superfamily protein [Helianthus annuus] Length = 386 Score = 72.8 bits (177), Expect = 2e-12 Identities = 36/47 (76%), Positives = 41/47 (87%) Frame = +1 Query: 241 MTSTGEHVVDRLSSLPQDVLSDILSLMPTKFAVRTSLLSKRWRYTWT 381 M+ST E+V D LS LP +VLS ILSLMPTK+AVRTS+LSKRWRYTWT Sbjct: 1 MSSTIENVDDMLSMLPGEVLSRILSLMPTKYAVRTSVLSKRWRYTWT 47 >ref|XP_022022562.1| FBD-associated F-box protein At4g10400-like [Helianthus annuus] Length = 435 Score = 72.8 bits (177), Expect = 2e-12 Identities = 33/47 (70%), Positives = 41/47 (87%) Frame = +1 Query: 238 EMTSTGEHVVDRLSSLPQDVLSDILSLMPTKFAVRTSLLSKRWRYTW 378 +M+S GE+ DRLS LP+D +S ILSLMPTK+AVRTS+LSKRWRY+W Sbjct: 7 KMSSIGENGDDRLSGLPEDTISHILSLMPTKYAVRTSILSKRWRYSW 53 >gb|OTF87705.1| putative FBD-associated F-box protein [Helianthus annuus] Length = 428 Score = 72.4 bits (176), Expect = 3e-12 Identities = 33/46 (71%), Positives = 40/46 (86%) Frame = +1 Query: 241 MTSTGEHVVDRLSSLPQDVLSDILSLMPTKFAVRTSLLSKRWRYTW 378 M+S GE+ DRLS LP+D +S ILSLMPTK+AVRTS+LSKRWRY+W Sbjct: 1 MSSIGENGDDRLSGLPEDTISHILSLMPTKYAVRTSILSKRWRYSW 46 >ref|XP_022021952.1| putative F-box/FBD/LRR-repeat protein At5g22670 [Helianthus annuus] Length = 417 Score = 72.0 bits (175), Expect = 4e-12 Identities = 33/46 (71%), Positives = 39/46 (84%) Frame = +1 Query: 241 MTSTGEHVVDRLSSLPQDVLSDILSLMPTKFAVRTSLLSKRWRYTW 378 M+S E V DRLS LP+D +S ILSLMPTKFAVRTS+L+KRWRY+W Sbjct: 1 MSSISEDVDDRLSGLPEDTISHILSLMPTKFAVRTSILAKRWRYSW 46 >ref|XP_022022071.1| F-box/LRR-repeat protein At4g14103-like [Helianthus annuus] ref|XP_022022072.1| F-box/LRR-repeat protein At4g14103-like [Helianthus annuus] gb|OTF87694.1| putative F-box domain, FBD domain, Leucine-rich repeat domain, L domain-like protein [Helianthus annuus] Length = 430 Score = 72.0 bits (175), Expect = 4e-12 Identities = 33/46 (71%), Positives = 40/46 (86%) Frame = +1 Query: 241 MTSTGEHVVDRLSSLPQDVLSDILSLMPTKFAVRTSLLSKRWRYTW 378 M+S GE+V DRLS LP+++LS ILSLMP KFAV+TS+LSKRWRY W Sbjct: 1 MSSIGENVDDRLSRLPEEILSHILSLMPMKFAVQTSILSKRWRYVW 46 >ref|XP_022021120.1| F-box/LRR-repeat protein At4g14103-like [Helianthus annuus] Length = 433 Score = 71.6 bits (174), Expect = 6e-12 Identities = 33/46 (71%), Positives = 40/46 (86%) Frame = +1 Query: 241 MTSTGEHVVDRLSSLPQDVLSDILSLMPTKFAVRTSLLSKRWRYTW 378 M+ST E+V DRLS LP+++LS ILSLMP KFAV+TS+LSKRWRY W Sbjct: 1 MSSTSENVDDRLSMLPEEILSHILSLMPMKFAVQTSILSKRWRYIW 46 >ref|XP_022021782.1| F-box/LRR-repeat protein At3g59200-like isoform X2 [Helianthus annuus] Length = 396 Score = 71.2 bits (173), Expect = 7e-12 Identities = 32/42 (76%), Positives = 39/42 (92%) Frame = +1 Query: 256 EHVVDRLSSLPQDVLSDILSLMPTKFAVRTSLLSKRWRYTWT 381 E+V DRLS LP+D+L+ ILSLMPTK+AV+TS+LSKRWRYTWT Sbjct: 63 ENVDDRLSMLPEDILARILSLMPTKYAVQTSILSKRWRYTWT 104