BLASTX nr result
ID: Chrysanthemum22_contig00016772
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00016772 (390 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_021993487.1| uncharacterized protein LOC110890206 isoform... 56 5e-07 ref|XP_021993486.1| uncharacterized protein LOC110890206 isoform... 56 8e-07 ref|XP_021993485.1| uncharacterized protein LOC110890206 isoform... 56 1e-06 ref|XP_021993484.1| uncharacterized protein LOC110890206 isoform... 56 1e-06 ref|XP_021993481.1| uncharacterized protein LOC110890206 isoform... 56 1e-06 >ref|XP_021993487.1| uncharacterized protein LOC110890206 isoform X5 [Helianthus annuus] Length = 160 Score = 55.8 bits (133), Expect = 5e-07 Identities = 24/32 (75%), Positives = 27/32 (84%) Frame = +3 Query: 291 QWFGACVGKAARHRLERGVWTSVHFGDIMRAL 386 +WFGAC+ KAA HRLERGVWTSV G+I RAL Sbjct: 10 KWFGACICKAAMHRLERGVWTSVRVGEIRRAL 41 >ref|XP_021993486.1| uncharacterized protein LOC110890206 isoform X4 [Helianthus annuus] Length = 200 Score = 55.8 bits (133), Expect = 8e-07 Identities = 24/32 (75%), Positives = 27/32 (84%) Frame = +3 Query: 291 QWFGACVGKAARHRLERGVWTSVHFGDIMRAL 386 +WFGAC+ KAA HRLERGVWTSV G+I RAL Sbjct: 81 KWFGACICKAAMHRLERGVWTSVRVGEIRRAL 112 >ref|XP_021993485.1| uncharacterized protein LOC110890206 isoform X3 [Helianthus annuus] Length = 229 Score = 55.8 bits (133), Expect = 1e-06 Identities = 24/32 (75%), Positives = 27/32 (84%) Frame = +3 Query: 291 QWFGACVGKAARHRLERGVWTSVHFGDIMRAL 386 +WFGAC+ KAA HRLERGVWTSV G+I RAL Sbjct: 79 KWFGACICKAAMHRLERGVWTSVRVGEIRRAL 110 >ref|XP_021993484.1| uncharacterized protein LOC110890206 isoform X2 [Helianthus annuus] Length = 229 Score = 55.8 bits (133), Expect = 1e-06 Identities = 24/32 (75%), Positives = 27/32 (84%) Frame = +3 Query: 291 QWFGACVGKAARHRLERGVWTSVHFGDIMRAL 386 +WFGAC+ KAA HRLERGVWTSV G+I RAL Sbjct: 79 KWFGACICKAAMHRLERGVWTSVRVGEIRRAL 110 >ref|XP_021993481.1| uncharacterized protein LOC110890206 isoform X1 [Helianthus annuus] ref|XP_021993482.1| uncharacterized protein LOC110890206 isoform X1 [Helianthus annuus] ref|XP_021993483.1| uncharacterized protein LOC110890206 isoform X1 [Helianthus annuus] Length = 231 Score = 55.8 bits (133), Expect = 1e-06 Identities = 24/32 (75%), Positives = 27/32 (84%) Frame = +3 Query: 291 QWFGACVGKAARHRLERGVWTSVHFGDIMRAL 386 +WFGAC+ KAA HRLERGVWTSV G+I RAL Sbjct: 81 KWFGACICKAAMHRLERGVWTSVRVGEIRRAL 112