BLASTX nr result
ID: Chrysanthemum22_contig00016740
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00016740 (354 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACH60906.1| cell division cycle protein, partial [Pseudotsuga... 64 5e-11 gb|ACH60902.1| cell division cycle protein, partial [Pseudotsuga... 64 5e-11 gb|ACH60883.1| cell division cycle protein, partial [Pseudotsuga... 64 5e-11 gb|ACH60900.1| cell division cycle protein, partial [Pseudotsuga... 64 7e-11 gb|KZV35171.1| cell division cycle protein 48 [Dorcoceras hygrom... 63 8e-11 gb|OTG27970.1| putative vps4 oligomerization [Helianthus annuus] 64 1e-10 ref|XP_023744865.1| cell division control protein 48 homolog D [... 67 1e-10 ref|XP_023744871.1| cell division control protein 48 homolog D-l... 67 1e-10 gb|PPD81654.1| hypothetical protein GOBAR_DD21413 [Gossypium bar... 66 3e-10 gb|PPR87734.1| hypothetical protein GOBAR_AA32948 [Gossypium bar... 66 3e-10 ref|XP_017630780.1| PREDICTED: cell division cycle protein 48 ho... 66 3e-10 ref|XP_016679841.1| PREDICTED: cell division cycle protein 48 ho... 66 3e-10 ref|XP_016733505.1| PREDICTED: cell division cycle protein 48 ho... 66 3e-10 ref|XP_012435184.1| PREDICTED: cell division cycle protein 48 ho... 66 3e-10 gb|KHG10269.1| Cell division cycle 48 [Gossypium arboreum] 66 3e-10 ref|XP_021994667.1| cell division control protein 48 homolog D-l... 66 3e-10 gb|KDO69537.1| hypothetical protein CISIN_1g0034992mg, partial [... 62 4e-10 ref|XP_020595149.1| cell division cycle protein 48 homolog [Phal... 64 5e-10 gb|PNX82831.1| cell division cycle protein 48 [Trifolium pratense] 64 5e-10 ref|XP_004246640.1| PREDICTED: cell division cycle protein 48 ho... 65 6e-10 >gb|ACH60906.1| cell division cycle protein, partial [Pseudotsuga macrocarpa] Length = 81 Score = 63.9 bits (154), Expect = 5e-11 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = +1 Query: 1 RRSVSDGDIRKYQAFAQTLQQSRGFGSEFKFAE 99 RRSVSD DIRKYQAFAQTLQQSRGFGSEF+FA+ Sbjct: 23 RRSVSDADIRKYQAFAQTLQQSRGFGSEFRFAD 55 >gb|ACH60902.1| cell division cycle protein, partial [Pseudotsuga menziesii] Length = 81 Score = 63.9 bits (154), Expect = 5e-11 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = +1 Query: 1 RRSVSDGDIRKYQAFAQTLQQSRGFGSEFKFAE 99 RRSVSD DIRKYQAFAQTLQQSRGFGSEF+FA+ Sbjct: 23 RRSVSDADIRKYQAFAQTLQQSRGFGSEFRFAD 55 >gb|ACH60883.1| cell division cycle protein, partial [Pseudotsuga menziesii] gb|ACH60884.1| cell division cycle protein, partial [Pseudotsuga menziesii] gb|ACH60885.1| cell division cycle protein, partial [Pseudotsuga menziesii] gb|ACH60886.1| cell division cycle protein, partial [Pseudotsuga menziesii] gb|ACH60887.1| cell division cycle protein, partial [Pseudotsuga menziesii] gb|ACH60888.1| cell division cycle protein, partial [Pseudotsuga menziesii] gb|ACH60889.1| cell division cycle protein, partial [Pseudotsuga menziesii] gb|ACH60890.1| cell division cycle protein, partial [Pseudotsuga menziesii] gb|ACH60891.1| cell division cycle protein, partial [Pseudotsuga menziesii] gb|ACH60892.1| cell division cycle protein, partial [Pseudotsuga menziesii] gb|ACH60893.1| cell division cycle protein, partial [Pseudotsuga menziesii] gb|ACH60894.1| cell division cycle protein, partial [Pseudotsuga menziesii] gb|ACH60895.1| cell division cycle protein, partial [Pseudotsuga menziesii] gb|ACH60896.1| cell division cycle protein, partial [Pseudotsuga menziesii] gb|ACH60897.1| cell division cycle protein, partial [Pseudotsuga menziesii] gb|ACH60898.1| cell division cycle protein, partial [Pseudotsuga menziesii] gb|ACH60899.1| cell division cycle protein, partial [Pseudotsuga menziesii] gb|ACH60901.1| cell division cycle protein, partial [Pseudotsuga menziesii] gb|ACH60903.1| cell division cycle protein, partial [Pseudotsuga menziesii] gb|ACH60904.1| cell division cycle protein, partial [Pseudotsuga menziesii] gb|ACH60905.1| cell division cycle protein, partial [Pseudotsuga menziesii] Length = 81 Score = 63.9 bits (154), Expect = 5e-11 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = +1 Query: 1 RRSVSDGDIRKYQAFAQTLQQSRGFGSEFKFAE 99 RRSVSD DIRKYQAFAQTLQQSRGFGSEF+FA+ Sbjct: 23 RRSVSDADIRKYQAFAQTLQQSRGFGSEFRFAD 55 >gb|ACH60900.1| cell division cycle protein, partial [Pseudotsuga menziesii] Length = 81 Score = 63.5 bits (153), Expect = 7e-11 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = +1 Query: 1 RRSVSDGDIRKYQAFAQTLQQSRGFGSEFKFAE 99 RRSVSD DIRKYQAFAQTLQQSRGFGSEF+FA+ Sbjct: 23 RRSVSDDDIRKYQAFAQTLQQSRGFGSEFRFAD 55 >gb|KZV35171.1| cell division cycle protein 48 [Dorcoceras hygrometricum] Length = 62 Score = 62.8 bits (151), Expect = 8e-11 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = +1 Query: 1 RRSVSDGDIRKYQAFAQTLQQSRGFGSEFKFAE 99 RRSVSD DIRKYQAFAQTLQQSRGFG++F+FAE Sbjct: 5 RRSVSDSDIRKYQAFAQTLQQSRGFGTDFRFAE 37 >gb|OTG27970.1| putative vps4 oligomerization [Helianthus annuus] Length = 110 Score = 63.9 bits (154), Expect = 1e-10 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = +1 Query: 1 RRSVSDGDIRKYQAFAQTLQQSRGFGSEFKFAE 99 RRSVSD DIRKYQAFAQTLQQSRGFGSEF+F+E Sbjct: 50 RRSVSDADIRKYQAFAQTLQQSRGFGSEFRFSE 82 >ref|XP_023744865.1| cell division control protein 48 homolog D [Lactuca sativa] gb|PLY65408.1| hypothetical protein LSAT_1X52061 [Lactuca sativa] Length = 810 Score = 67.4 bits (163), Expect = 1e-10 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = +1 Query: 1 RRSVSDGDIRKYQAFAQTLQQSRGFGSEFKFAE 99 RRSVSDGDIRKYQAFAQTLQQSRGFGSEF+FAE Sbjct: 749 RRSVSDGDIRKYQAFAQTLQQSRGFGSEFRFAE 781 >ref|XP_023744871.1| cell division control protein 48 homolog D-like [Lactuca sativa] gb|PLY65392.1| hypothetical protein LSAT_1X52021 [Lactuca sativa] Length = 810 Score = 67.4 bits (163), Expect = 1e-10 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = +1 Query: 1 RRSVSDGDIRKYQAFAQTLQQSRGFGSEFKFAE 99 RRSVSDGDIRKYQAFAQTLQQSRGFGSEF+FAE Sbjct: 749 RRSVSDGDIRKYQAFAQTLQQSRGFGSEFRFAE 781 >gb|PPD81654.1| hypothetical protein GOBAR_DD21413 [Gossypium barbadense] Length = 787 Score = 66.2 bits (160), Expect = 3e-10 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = +1 Query: 1 RRSVSDGDIRKYQAFAQTLQQSRGFGSEFKFAE 99 RRSVSD DIRKYQAFAQTLQQSRGFGSEFKFAE Sbjct: 730 RRSVSDADIRKYQAFAQTLQQSRGFGSEFKFAE 762 >gb|PPR87734.1| hypothetical protein GOBAR_AA32948 [Gossypium barbadense] Length = 805 Score = 66.2 bits (160), Expect = 3e-10 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = +1 Query: 1 RRSVSDGDIRKYQAFAQTLQQSRGFGSEFKFAE 99 RRSVSD DIRKYQAFAQTLQQSRGFGSEFKFAE Sbjct: 748 RRSVSDADIRKYQAFAQTLQQSRGFGSEFKFAE 780 >ref|XP_017630780.1| PREDICTED: cell division cycle protein 48 homolog [Gossypium arboreum] Length = 805 Score = 66.2 bits (160), Expect = 3e-10 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = +1 Query: 1 RRSVSDGDIRKYQAFAQTLQQSRGFGSEFKFAE 99 RRSVSD DIRKYQAFAQTLQQSRGFGSEFKFAE Sbjct: 748 RRSVSDADIRKYQAFAQTLQQSRGFGSEFKFAE 780 >ref|XP_016679841.1| PREDICTED: cell division cycle protein 48 homolog [Gossypium hirsutum] Length = 805 Score = 66.2 bits (160), Expect = 3e-10 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = +1 Query: 1 RRSVSDGDIRKYQAFAQTLQQSRGFGSEFKFAE 99 RRSVSD DIRKYQAFAQTLQQSRGFGSEFKFAE Sbjct: 748 RRSVSDADIRKYQAFAQTLQQSRGFGSEFKFAE 780 >ref|XP_016733505.1| PREDICTED: cell division cycle protein 48 homolog [Gossypium hirsutum] Length = 805 Score = 66.2 bits (160), Expect = 3e-10 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = +1 Query: 1 RRSVSDGDIRKYQAFAQTLQQSRGFGSEFKFAE 99 RRSVSD DIRKYQAFAQTLQQSRGFGSEFKFAE Sbjct: 748 RRSVSDADIRKYQAFAQTLQQSRGFGSEFKFAE 780 >ref|XP_012435184.1| PREDICTED: cell division cycle protein 48 homolog [Gossypium raimondii] gb|KJB46511.1| hypothetical protein B456_007G373300 [Gossypium raimondii] Length = 805 Score = 66.2 bits (160), Expect = 3e-10 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = +1 Query: 1 RRSVSDGDIRKYQAFAQTLQQSRGFGSEFKFAE 99 RRSVSD DIRKYQAFAQTLQQSRGFGSEFKFAE Sbjct: 748 RRSVSDADIRKYQAFAQTLQQSRGFGSEFKFAE 780 >gb|KHG10269.1| Cell division cycle 48 [Gossypium arboreum] Length = 805 Score = 66.2 bits (160), Expect = 3e-10 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = +1 Query: 1 RRSVSDGDIRKYQAFAQTLQQSRGFGSEFKFAE 99 RRSVSD DIRKYQAFAQTLQQSRGFGSEFKFAE Sbjct: 748 RRSVSDADIRKYQAFAQTLQQSRGFGSEFKFAE 780 >ref|XP_021994667.1| cell division control protein 48 homolog D-like [Helianthus annuus] gb|OTG09205.1| putative ATPase, AAA-type, core [Helianthus annuus] Length = 808 Score = 66.2 bits (160), Expect = 3e-10 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = +1 Query: 1 RRSVSDGDIRKYQAFAQTLQQSRGFGSEFKFAE 99 RRSVSD DIRKYQAFAQTLQQSRGFGSEFKFAE Sbjct: 748 RRSVSDADIRKYQAFAQTLQQSRGFGSEFKFAE 780 >gb|KDO69537.1| hypothetical protein CISIN_1g0034992mg, partial [Citrus sinensis] Length = 99 Score = 62.0 bits (149), Expect = 4e-10 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +1 Query: 1 RRSVSDGDIRKYQAFAQTLQQSRGFGSEFKFAE 99 RRSVSD DIRKYQ FAQTLQQSRGFGSEF+FA+ Sbjct: 39 RRSVSDADIRKYQLFAQTLQQSRGFGSEFRFAD 71 >ref|XP_020595149.1| cell division cycle protein 48 homolog [Phalaenopsis equestris] Length = 196 Score = 63.9 bits (154), Expect = 5e-10 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = +1 Query: 1 RRSVSDGDIRKYQAFAQTLQQSRGFGSEFKFAE 99 RRSVSD DIRKYQAFAQTLQQSRGFGSEF+FA+ Sbjct: 137 RRSVSDADIRKYQAFAQTLQQSRGFGSEFRFAD 169 >gb|PNX82831.1| cell division cycle protein 48 [Trifolium pratense] Length = 197 Score = 63.9 bits (154), Expect = 5e-10 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = +1 Query: 1 RRSVSDGDIRKYQAFAQTLQQSRGFGSEFKFAE 99 RRSVSD DIRKYQAFAQTLQQSRGFGSEF+FA+ Sbjct: 137 RRSVSDADIRKYQAFAQTLQQSRGFGSEFRFAD 169 >ref|XP_004246640.1| PREDICTED: cell division cycle protein 48 homolog [Solanum lycopersicum] Length = 808 Score = 65.5 bits (158), Expect = 6e-10 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +1 Query: 1 RRSVSDGDIRKYQAFAQTLQQSRGFGSEFKFA 96 RRSVSDGDIRKYQAFAQTLQQSRGFGSEF+FA Sbjct: 748 RRSVSDGDIRKYQAFAQTLQQSRGFGSEFRFA 779