BLASTX nr result
ID: Chrysanthemum22_contig00016678
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00016678 (644 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023750470.1| kinesin-like protein KIN-4C [Lactuca sativa]... 60 5e-07 gb|KVH99689.1| Kinesin, motor domain-containing protein [Cynara ... 59 1e-06 ref|XP_022039858.1| kinesin-like protein KIN-4C isoform X2 [Heli... 59 2e-06 ref|XP_022039857.1| kinesin-like protein KIN-4C isoform X1 [Heli... 59 2e-06 >ref|XP_023750470.1| kinesin-like protein KIN-4C [Lactuca sativa] gb|PLY95532.1| hypothetical protein LSAT_6X104981 [Lactuca sativa] Length = 1304 Score = 60.5 bits (145), Expect = 5e-07 Identities = 31/45 (68%), Positives = 36/45 (80%) Frame = +3 Query: 315 ARPSREPIQIR*LAKGRISVADVTEIEVTSKEEMPSFLVRGSLCK 449 A PSR PIQIR A G IS+A VTE EVTS+EEM SFL+RGS+C+ Sbjct: 169 AGPSRAPIQIRETANGGISLAGVTEAEVTSQEEMASFLLRGSVCR 213 >gb|KVH99689.1| Kinesin, motor domain-containing protein [Cynara cardunculus var. scolymus] Length = 1239 Score = 59.3 bits (142), Expect = 1e-06 Identities = 30/45 (66%), Positives = 36/45 (80%) Frame = +3 Query: 315 ARPSREPIQIR*LAKGRISVADVTEIEVTSKEEMPSFLVRGSLCK 449 A PSR PIQIR A G IS+A VTE EVTS++EM SFL+RGS+C+ Sbjct: 215 AGPSRAPIQIRETANGGISLAGVTEAEVTSQDEMASFLLRGSVCR 259 >ref|XP_022039858.1| kinesin-like protein KIN-4C isoform X2 [Helianthus annuus] Length = 1318 Score = 58.5 bits (140), Expect = 2e-06 Identities = 29/43 (67%), Positives = 35/43 (81%) Frame = +3 Query: 321 PSREPIQIR*LAKGRISVADVTEIEVTSKEEMPSFLVRGSLCK 449 PSR PIQIR A G IS+A VTE EVTS+EEM S+L+RGS+C+ Sbjct: 170 PSRAPIQIRETANGGISLAGVTEAEVTSQEEMASYLLRGSVCR 212 >ref|XP_022039857.1| kinesin-like protein KIN-4C isoform X1 [Helianthus annuus] gb|OTG26861.1| putative P-loop containing nucleoside triphosphate hydrolases superfamily protein [Helianthus annuus] Length = 1319 Score = 58.5 bits (140), Expect = 2e-06 Identities = 29/43 (67%), Positives = 35/43 (81%) Frame = +3 Query: 321 PSREPIQIR*LAKGRISVADVTEIEVTSKEEMPSFLVRGSLCK 449 PSR PIQIR A G IS+A VTE EVTS+EEM S+L+RGS+C+ Sbjct: 170 PSRAPIQIRETANGGISLAGVTEAEVTSQEEMASYLLRGSVCR 212