BLASTX nr result
ID: Chrysanthemum22_contig00016647
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00016647 (573 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023767571.1| uncharacterized protein LOC111916170 [Lactuc... 58 3e-07 >ref|XP_023767571.1| uncharacterized protein LOC111916170 [Lactuca sativa] Length = 172 Score = 58.2 bits (139), Expect = 3e-07 Identities = 37/110 (33%), Positives = 51/110 (46%), Gaps = 20/110 (18%) Frame = -3 Query: 571 IAASIQQHTIVAFIRSYETTFRGQAEVKVSVIKAYKLDERPTPNLISLQPEKQ------- 413 IAA+++ +VAF+R Y F G E+KVS++KAYK DE P PN+ + P Sbjct: 62 IAAALELSEVVAFVRLYVICFHGVKEMKVSIVKAYKGDENPNPNITIVLPNSPSPTLNKH 121 Query: 412 ------ASQSTPPDVNPSITSITC-------LPEKQSTEPVAKPSTDKGK 302 ++ S P P +TS C LP K P A+ K K Sbjct: 122 LVISVGSTISAPTTHFPDVTSTCCSKSVTTLLPTKTEHNPEARDKRPKKK 171