BLASTX nr result
ID: Chrysanthemum22_contig00016483
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00016483 (438 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023736058.1| putative DNA helicase INO80 [Lactuca sativa]... 57 1e-06 >ref|XP_023736058.1| putative DNA helicase INO80 [Lactuca sativa] gb|PLY72073.1| hypothetical protein LSAT_9X121880 [Lactuca sativa] Length = 497 Score = 57.0 bits (136), Expect = 1e-06 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = +3 Query: 57 METRGGFSFSNISQTTRKKRSDRRPRNDIQPE 152 ME+ GGFSF++++QT RKKRSDRRPRNDIQPE Sbjct: 1 MESSGGFSFNDMNQTMRKKRSDRRPRNDIQPE 32