BLASTX nr result
ID: Chrysanthemum22_contig00016341
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00016341 (1066 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|OON03944.1| hypothetical protein BSLG_05848, partial [Batrach... 56 8e-06 >gb|OON03944.1| hypothetical protein BSLG_05848, partial [Batrachochytrium salamandrivorans] Length = 171 Score = 56.2 bits (134), Expect = 8e-06 Identities = 28/44 (63%), Positives = 31/44 (70%), Gaps = 3/44 (6%) Frame = +1 Query: 193 VYGTFATSGYDAAFNFWDKDRKQRLKVSP---AGINESVQNRSG 315 VYGTF+T G D AFNFWDKD KQRLK+ P A I S NR+G Sbjct: 84 VYGTFSTVGADGAFNFWDKDSKQRLKLGPNVGAPITSSAFNRNG 127