BLASTX nr result
ID: Chrysanthemum22_contig00015907
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00015907 (837 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_015886034.1| PREDICTED: E3 ubiquitin-protein ligase UPL1-... 70 1e-11 gb|PKI73094.1| hypothetical protein CRG98_006502 [Punica granatum] 69 4e-11 ref|XP_022019794.1| E3 ubiquitin-protein ligase UPL2-like [Helia... 73 1e-10 ref|XP_023746600.1| E3 ubiquitin-protein ligase UPL2-like [Lactu... 73 1e-10 gb|PLY64136.1| hypothetical protein LSAT_1X2001 [Lactuca sativa] 73 1e-10 ref|XP_016461731.1| PREDICTED: E3 ubiquitin-protein ligase UPL2-... 72 3e-10 ref|XP_009607450.1| PREDICTED: E3 ubiquitin-protein ligase UPL2-... 72 3e-10 ref|XP_009607449.1| PREDICTED: E3 ubiquitin-protein ligase UPL2-... 72 3e-10 emb|CAN72160.1| hypothetical protein VITISV_019023 [Vitis vinifera] 70 4e-10 gb|OMO57546.1| hypothetical protein COLO4_35278 [Corchorus olito... 71 5e-10 gb|PPR81704.1| hypothetical protein GOBAR_AA39010 [Gossypium bar... 70 5e-10 gb|KOM47519.1| hypothetical protein LR48_Vigan07g122300 [Vigna a... 71 6e-10 ref|XP_017429269.1| PREDICTED: E3 ubiquitin-protein ligase UPL1-... 71 6e-10 ref|XP_018859301.1| PREDICTED: E3 ubiquitin-protein ligase UPL1-... 70 6e-10 ref|XP_018859300.1| PREDICTED: E3 ubiquitin-protein ligase UPL1-... 70 6e-10 gb|PNT49111.1| hypothetical protein POPTR_002G110500v3 [Populus ... 70 6e-10 ref|XP_004490458.1| PREDICTED: E3 ubiquitin-protein ligase UPL1-... 70 7e-10 ref|XP_016731533.1| PREDICTED: E3 ubiquitin-protein ligase UPL1-... 70 8e-10 emb|CBI19293.3| unnamed protein product, partial [Vitis vinifera] 70 8e-10 gb|KZV41606.1| hypothetical protein F511_15375 [Dorcoceras hygro... 70 8e-10 >ref|XP_015886034.1| PREDICTED: E3 ubiquitin-protein ligase UPL1-like [Ziziphus jujuba] Length = 113 Score = 70.5 bits (171), Expect = 1e-11 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = -1 Query: 405 RFPLGGFSALQGISGSQKFQIHKAYGRPDHLPSAHTWY 292 + PL GFSALQGISGSQKFQIHKAYG PDHLPSAHT + Sbjct: 44 KVPLEGFSALQGISGSQKFQIHKAYGSPDHLPSAHTCF 81 >gb|PKI73094.1| hypothetical protein CRG98_006502 [Punica granatum] Length = 113 Score = 68.9 bits (167), Expect = 4e-11 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = -1 Query: 405 RFPLGGFSALQGISGSQKFQIHKAYGRPDHLPSAHTWY 292 + PL GFSALQGISGSQKFQIHKAYG P+HLPSAHT + Sbjct: 44 KVPLEGFSALQGISGSQKFQIHKAYGSPEHLPSAHTCF 81 >ref|XP_022019794.1| E3 ubiquitin-protein ligase UPL2-like [Helianthus annuus] gb|OTG34446.1| putative HECT domain-containing protein [Helianthus annuus] Length = 3584 Score = 72.8 bits (177), Expect = 1e-10 Identities = 33/38 (86%), Positives = 35/38 (92%) Frame = -1 Query: 405 RFPLGGFSALQGISGSQKFQIHKAYGRPDHLPSAHTWY 292 + PL GFSALQGISGSQKFQIHKAYGRPDHLPSAHT + Sbjct: 3515 KVPLEGFSALQGISGSQKFQIHKAYGRPDHLPSAHTCF 3552 >ref|XP_023746600.1| E3 ubiquitin-protein ligase UPL2-like [Lactuca sativa] Length = 3606 Score = 72.8 bits (177), Expect = 1e-10 Identities = 33/38 (86%), Positives = 35/38 (92%) Frame = -1 Query: 405 RFPLGGFSALQGISGSQKFQIHKAYGRPDHLPSAHTWY 292 + PL GFSALQGISGSQKFQIHKAYGRPDHLPSAHT + Sbjct: 3537 KVPLEGFSALQGISGSQKFQIHKAYGRPDHLPSAHTCF 3574 >gb|PLY64136.1| hypothetical protein LSAT_1X2001 [Lactuca sativa] Length = 3683 Score = 72.8 bits (177), Expect = 1e-10 Identities = 33/38 (86%), Positives = 35/38 (92%) Frame = -1 Query: 405 RFPLGGFSALQGISGSQKFQIHKAYGRPDHLPSAHTWY 292 + PL GFSALQGISGSQKFQIHKAYGRPDHLPSAHT + Sbjct: 3614 KVPLEGFSALQGISGSQKFQIHKAYGRPDHLPSAHTCF 3651 >ref|XP_016461731.1| PREDICTED: E3 ubiquitin-protein ligase UPL2-like [Nicotiana tabacum] Length = 3382 Score = 71.6 bits (174), Expect = 3e-10 Identities = 33/38 (86%), Positives = 34/38 (89%) Frame = -1 Query: 405 RFPLGGFSALQGISGSQKFQIHKAYGRPDHLPSAHTWY 292 R PL GFSALQGISGSQKFQIHKAYG PDHLPSAHT + Sbjct: 3313 RVPLEGFSALQGISGSQKFQIHKAYGSPDHLPSAHTCF 3350 >ref|XP_009607450.1| PREDICTED: E3 ubiquitin-protein ligase UPL2-like isoform X2 [Nicotiana tomentosiformis] Length = 3650 Score = 71.6 bits (174), Expect = 3e-10 Identities = 33/38 (86%), Positives = 34/38 (89%) Frame = -1 Query: 405 RFPLGGFSALQGISGSQKFQIHKAYGRPDHLPSAHTWY 292 R PL GFSALQGISGSQKFQIHKAYG PDHLPSAHT + Sbjct: 3581 RVPLEGFSALQGISGSQKFQIHKAYGSPDHLPSAHTCF 3618 >ref|XP_009607449.1| PREDICTED: E3 ubiquitin-protein ligase UPL2-like isoform X1 [Nicotiana tomentosiformis] Length = 3658 Score = 71.6 bits (174), Expect = 3e-10 Identities = 33/38 (86%), Positives = 34/38 (89%) Frame = -1 Query: 405 RFPLGGFSALQGISGSQKFQIHKAYGRPDHLPSAHTWY 292 R PL GFSALQGISGSQKFQIHKAYG PDHLPSAHT + Sbjct: 3589 RVPLEGFSALQGISGSQKFQIHKAYGSPDHLPSAHTCF 3626 >emb|CAN72160.1| hypothetical protein VITISV_019023 [Vitis vinifera] Length = 345 Score = 70.5 bits (171), Expect = 4e-10 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = -1 Query: 405 RFPLGGFSALQGISGSQKFQIHKAYGRPDHLPSAHTWY 292 + PL GFSALQGISGSQKFQIHKAYG PDHLPSAHT + Sbjct: 276 KVPLEGFSALQGISGSQKFQIHKAYGSPDHLPSAHTCF 313 >gb|OMO57546.1| hypothetical protein COLO4_35278 [Corchorus olitorius] Length = 3696 Score = 71.2 bits (173), Expect = 5e-10 Identities = 33/39 (84%), Positives = 34/39 (87%) Frame = -1 Query: 408 LRFPLGGFSALQGISGSQKFQIHKAYGRPDHLPSAHTWY 292 L PL GFSALQGISGSQKFQIHKAYG PDHLPSAHT + Sbjct: 3626 LEVPLEGFSALQGISGSQKFQIHKAYGSPDHLPSAHTCF 3664 >gb|PPR81704.1| hypothetical protein GOBAR_AA39010 [Gossypium barbadense] Length = 454 Score = 70.5 bits (171), Expect = 5e-10 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = -1 Query: 405 RFPLGGFSALQGISGSQKFQIHKAYGRPDHLPSAHTWY 292 + PL GFSALQGISGSQKFQIHKAYG PDHLPSAHT + Sbjct: 385 KVPLEGFSALQGISGSQKFQIHKAYGSPDHLPSAHTCF 422 >gb|KOM47519.1| hypothetical protein LR48_Vigan07g122300 [Vigna angularis] Length = 3588 Score = 70.9 bits (172), Expect = 6e-10 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = -1 Query: 405 RFPLGGFSALQGISGSQKFQIHKAYGRPDHLPSAHTWY 292 + PL GFSALQGISGSQKFQIHKAYG PDHLPSAHT + Sbjct: 3519 KVPLDGFSALQGISGSQKFQIHKAYGSPDHLPSAHTCF 3556 >ref|XP_017429269.1| PREDICTED: E3 ubiquitin-protein ligase UPL1-like [Vigna angularis] dbj|BAT81688.1| hypothetical protein VIGAN_03147800 [Vigna angularis var. angularis] Length = 3644 Score = 70.9 bits (172), Expect = 6e-10 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = -1 Query: 405 RFPLGGFSALQGISGSQKFQIHKAYGRPDHLPSAHTWY 292 + PL GFSALQGISGSQKFQIHKAYG PDHLPSAHT + Sbjct: 3575 KVPLDGFSALQGISGSQKFQIHKAYGSPDHLPSAHTCF 3612 >ref|XP_018859301.1| PREDICTED: E3 ubiquitin-protein ligase UPL1-like isoform X2 [Juglans regia] ref|XP_018859302.1| PREDICTED: E3 ubiquitin-protein ligase UPL1-like isoform X2 [Juglans regia] Length = 627 Score = 70.5 bits (171), Expect = 6e-10 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = -1 Query: 405 RFPLGGFSALQGISGSQKFQIHKAYGRPDHLPSAHTWY 292 + PL GFSALQGISGSQKFQIHKAYG PDHLPSAHT + Sbjct: 558 KVPLEGFSALQGISGSQKFQIHKAYGSPDHLPSAHTCF 595 >ref|XP_018859300.1| PREDICTED: E3 ubiquitin-protein ligase UPL1-like isoform X1 [Juglans regia] Length = 644 Score = 70.5 bits (171), Expect = 6e-10 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = -1 Query: 405 RFPLGGFSALQGISGSQKFQIHKAYGRPDHLPSAHTWY 292 + PL GFSALQGISGSQKFQIHKAYG PDHLPSAHT + Sbjct: 575 KVPLEGFSALQGISGSQKFQIHKAYGSPDHLPSAHTCF 612 >gb|PNT49111.1| hypothetical protein POPTR_002G110500v3 [Populus trichocarpa] Length = 690 Score = 70.5 bits (171), Expect = 6e-10 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = -1 Query: 405 RFPLGGFSALQGISGSQKFQIHKAYGRPDHLPSAHTWY 292 + PL GFSALQGISGSQKFQIHKAYG PDHLPSAHT + Sbjct: 621 KVPLEGFSALQGISGSQKFQIHKAYGSPDHLPSAHTCF 658 >ref|XP_004490458.1| PREDICTED: E3 ubiquitin-protein ligase UPL1-like [Cicer arietinum] Length = 1260 Score = 70.5 bits (171), Expect = 7e-10 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = -1 Query: 405 RFPLGGFSALQGISGSQKFQIHKAYGRPDHLPSAHTWY 292 + PL GFSALQGISGSQKFQIHKAYG PDHLPSAHT + Sbjct: 1191 KVPLEGFSALQGISGSQKFQIHKAYGSPDHLPSAHTCF 1228 >ref|XP_016731533.1| PREDICTED: E3 ubiquitin-protein ligase UPL1-like, partial [Gossypium hirsutum] Length = 1498 Score = 70.5 bits (171), Expect = 8e-10 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = -1 Query: 405 RFPLGGFSALQGISGSQKFQIHKAYGRPDHLPSAHTWY 292 + PL GFSALQGISGSQKFQIHKAYG PDHLPSAHT + Sbjct: 1429 KVPLEGFSALQGISGSQKFQIHKAYGSPDHLPSAHTCF 1466 >emb|CBI19293.3| unnamed protein product, partial [Vitis vinifera] Length = 1824 Score = 70.5 bits (171), Expect = 8e-10 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = -1 Query: 405 RFPLGGFSALQGISGSQKFQIHKAYGRPDHLPSAHTWY 292 + PL GFSALQGISGSQKFQIHKAYG PDHLPSAHT + Sbjct: 1755 KVPLEGFSALQGISGSQKFQIHKAYGSPDHLPSAHTCF 1792 >gb|KZV41606.1| hypothetical protein F511_15375 [Dorcoceras hygrometricum] Length = 2013 Score = 70.5 bits (171), Expect = 8e-10 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = -1 Query: 405 RFPLGGFSALQGISGSQKFQIHKAYGRPDHLPSAHTWY 292 + PL GFSALQGISGSQKFQIHKAYG PDHLPSAHT + Sbjct: 1944 KVPLEGFSALQGISGSQKFQIHKAYGTPDHLPSAHTCF 1981