BLASTX nr result
ID: Chrysanthemum22_contig00015884
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00015884 (592 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_021734564.1| uncharacterized protein LOC110701257 isoform... 70 3e-11 gb|POE61869.1| hypothetical protein CFP56_77985 [Quercus suber] 61 3e-09 dbj|GAV62179.1| hypothetical protein CFOL_v3_05703 [Cephalotus f... 64 5e-09 ref|XP_021980928.1| uncharacterized protein LOC110877078 [Helian... 64 6e-09 ref|XP_004135689.1| PREDICTED: uncharacterized protein LOC101204... 63 8e-09 ref|XP_009420855.1| PREDICTED: uncharacterized protein LOC104000... 63 1e-08 gb|OMO67361.1| hypothetical protein CCACVL1_20583 [Corchorus cap... 63 1e-08 ref|XP_018819045.1| PREDICTED: uncharacterized protein LOC108989... 63 1e-08 gb|KDO55928.1| hypothetical protein CISIN_1g029391mg [Citrus sin... 63 1e-08 ref|XP_006451372.1| uncharacterized protein LOC18055662 [Citrus ... 63 1e-08 gb|OMO91645.1| hypothetical protein COLO4_18251 [Corchorus olito... 63 1e-08 ref|XP_008806694.1| PREDICTED: uncharacterized protein LOC103719... 62 2e-08 ref|XP_021862011.1| uncharacterized protein LOC110801008 [Spinac... 62 2e-08 ref|XP_012442831.1| PREDICTED: uncharacterized protein LOC105767... 62 2e-08 ref|XP_010924944.1| PREDICTED: uncharacterized protein LOC105047... 62 2e-08 gb|PPD83508.1| hypothetical protein GOBAR_DD19564 [Gossypium bar... 62 3e-08 gb|PKI51405.1| hypothetical protein CRG98_028201 [Punica granatum] 62 3e-08 ref|XP_021734566.1| uncharacterized protein LOC110701257 isoform... 62 3e-08 ref|XP_021772530.1| uncharacterized protein LOC110736583 [Chenop... 62 3e-08 ref|XP_016689901.1| PREDICTED: uncharacterized protein LOC107907... 62 3e-08 >ref|XP_021734564.1| uncharacterized protein LOC110701257 isoform X1 [Chenopodium quinoa] Length = 205 Score = 69.7 bits (169), Expect = 3e-11 Identities = 31/44 (70%), Positives = 34/44 (77%) Frame = +3 Query: 456 LYYFPLDGSMFHAFLACRLPKFRWDVIWLPLGPLSGAGFCLYVD 587 LYY M ++F+ CRLPKFRWDVIWLP GPLSGAG CLYVD Sbjct: 145 LYY------MLNSFMYCRLPKFRWDVIWLPFGPLSGAGICLYVD 182 >gb|POE61869.1| hypothetical protein CFP56_77985 [Quercus suber] Length = 66 Score = 61.2 bits (147), Expect = 3e-09 Identities = 26/35 (74%), Positives = 27/35 (77%) Frame = +3 Query: 483 MFHAFLACRLPKFRWDVIWLPLGPLSGAGFCLYVD 587 +F L RLPKFRWDVIWLP GPL GAG CLYVD Sbjct: 9 LFDTSLGGRLPKFRWDVIWLPFGPLGGAGVCLYVD 43 >dbj|GAV62179.1| hypothetical protein CFOL_v3_05703 [Cephalotus follicularis] Length = 194 Score = 63.5 bits (153), Expect = 5e-09 Identities = 25/36 (69%), Positives = 29/36 (80%) Frame = +3 Query: 480 SMFHAFLACRLPKFRWDVIWLPLGPLSGAGFCLYVD 587 +MF + R+PKFRWDVIWLP GPLSGAG CLY+D Sbjct: 136 AMFWLYFMLRIPKFRWDVIWLPFGPLSGAGICLYID 171 >ref|XP_021980928.1| uncharacterized protein LOC110877078 [Helianthus annuus] gb|OTG13473.1| hypothetical protein HannXRQ_Chr09g0238511 [Helianthus annuus] Length = 195 Score = 63.5 bits (153), Expect = 6e-09 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +3 Query: 480 SMFHAFLACRLPKFRWDVIWLPLGPLSGAGFCLYVDT 590 ++F + +L KFRWDVIWLPLGPLSGAGFCLYVDT Sbjct: 137 AVFWLYNMLKLDKFRWDVIWLPLGPLSGAGFCLYVDT 173 >ref|XP_004135689.1| PREDICTED: uncharacterized protein LOC101204679 [Cucumis sativus] gb|KGN66204.1| hypothetical protein Csa_1G580190 [Cucumis sativus] Length = 199 Score = 63.2 bits (152), Expect = 8e-09 Identities = 27/36 (75%), Positives = 29/36 (80%) Frame = +3 Query: 480 SMFHAFLACRLPKFRWDVIWLPLGPLSGAGFCLYVD 587 S+F + LPKFRWDVIWLPLGPLSGAG CLYVD Sbjct: 141 SVFWFYFMMSLPKFRWDVIWLPLGPLSGAGICLYVD 176 >ref|XP_009420855.1| PREDICTED: uncharacterized protein LOC104000495 [Musa acuminata subsp. malaccensis] Length = 191 Score = 62.8 bits (151), Expect = 1e-08 Identities = 28/42 (66%), Positives = 31/42 (73%) Frame = +3 Query: 462 YFPLDGSMFHAFLACRLPKFRWDVIWLPLGPLSGAGFCLYVD 587 Y L ++F RLPKFRWDV+WLPLGPLSGAG CLYVD Sbjct: 127 YVGLLHAVFWLIYMFRLPKFRWDVLWLPLGPLSGAGICLYVD 168 >gb|OMO67361.1| hypothetical protein CCACVL1_20583 [Corchorus capsularis] Length = 192 Score = 62.8 bits (151), Expect = 1e-08 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = +3 Query: 480 SMFHAFLACRLPKFRWDVIWLPLGPLSGAGFCLYVD 587 ++F + RLP+FRWDVIWLPLGPLSGAG CLYVD Sbjct: 134 AVFWLYYMLRLPRFRWDVIWLPLGPLSGAGVCLYVD 169 >ref|XP_018819045.1| PREDICTED: uncharacterized protein LOC108989767 [Juglans regia] Length = 192 Score = 62.8 bits (151), Expect = 1e-08 Identities = 26/36 (72%), Positives = 29/36 (80%) Frame = +3 Query: 480 SMFHAFLACRLPKFRWDVIWLPLGPLSGAGFCLYVD 587 ++F + RLPKFRWDVIWLP GPLSGAG CLYVD Sbjct: 134 AVFWLYYMLRLPKFRWDVIWLPFGPLSGAGICLYVD 169 >gb|KDO55928.1| hypothetical protein CISIN_1g029391mg [Citrus sinensis] Length = 194 Score = 62.8 bits (151), Expect = 1e-08 Identities = 26/36 (72%), Positives = 29/36 (80%) Frame = +3 Query: 480 SMFHAFLACRLPKFRWDVIWLPLGPLSGAGFCLYVD 587 ++F + RLPKFRWDVIWLP GPLSGAG CLYVD Sbjct: 136 AVFWLYYMLRLPKFRWDVIWLPFGPLSGAGICLYVD 171 >ref|XP_006451372.1| uncharacterized protein LOC18055662 [Citrus clementina] ref|XP_006475375.1| PREDICTED: uncharacterized protein LOC102611767 [Citrus sinensis] gb|ESR64612.1| hypothetical protein CICLE_v10009577mg [Citrus clementina] dbj|GAY50419.1| hypothetical protein CUMW_126500 [Citrus unshiu] Length = 194 Score = 62.8 bits (151), Expect = 1e-08 Identities = 26/36 (72%), Positives = 29/36 (80%) Frame = +3 Query: 480 SMFHAFLACRLPKFRWDVIWLPLGPLSGAGFCLYVD 587 ++F + RLPKFRWDVIWLP GPLSGAG CLYVD Sbjct: 136 AVFWLYYMLRLPKFRWDVIWLPFGPLSGAGICLYVD 171 >gb|OMO91645.1| hypothetical protein COLO4_18251 [Corchorus olitorius] Length = 205 Score = 62.8 bits (151), Expect = 1e-08 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = +3 Query: 480 SMFHAFLACRLPKFRWDVIWLPLGPLSGAGFCLYVD 587 ++F + RLP+FRWDVIWLPLGPLSGAG CLYVD Sbjct: 147 AVFWLYYMLRLPRFRWDVIWLPLGPLSGAGVCLYVD 182 >ref|XP_008806694.1| PREDICTED: uncharacterized protein LOC103719289 [Phoenix dactylifera] Length = 198 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/36 (69%), Positives = 29/36 (80%) Frame = +3 Query: 480 SMFHAFLACRLPKFRWDVIWLPLGPLSGAGFCLYVD 587 ++F + RLPKFRWD+IWLP GPLSGAG CLYVD Sbjct: 144 TIFWLYYMLRLPKFRWDIIWLPFGPLSGAGICLYVD 179 >ref|XP_021862011.1| uncharacterized protein LOC110801008 [Spinacia oleracea] gb|KNA20208.1| hypothetical protein SOVF_054490 [Spinacia oleracea] Length = 201 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/36 (69%), Positives = 29/36 (80%) Frame = +3 Query: 480 SMFHAFLACRLPKFRWDVIWLPLGPLSGAGFCLYVD 587 ++F + RLPKFRWD+IWLP GPLSGAG CLYVD Sbjct: 143 AVFWLYYMLRLPKFRWDIIWLPFGPLSGAGICLYVD 178 >ref|XP_012442831.1| PREDICTED: uncharacterized protein LOC105767807 isoform X2 [Gossypium raimondii] gb|KJB54280.1| hypothetical protein B456_009G029800 [Gossypium raimondii] Length = 178 Score = 61.6 bits (148), Expect = 2e-08 Identities = 25/36 (69%), Positives = 29/36 (80%) Frame = +3 Query: 480 SMFHAFLACRLPKFRWDVIWLPLGPLSGAGFCLYVD 587 ++F + R+PKFRWDVIWLPLGPL GAG CLYVD Sbjct: 120 AIFWVYYMLRMPKFRWDVIWLPLGPLCGAGVCLYVD 155 >ref|XP_010924944.1| PREDICTED: uncharacterized protein LOC105047631 [Elaeis guineensis] Length = 202 Score = 62.0 bits (149), Expect = 2e-08 Identities = 25/36 (69%), Positives = 29/36 (80%) Frame = +3 Query: 480 SMFHAFLACRLPKFRWDVIWLPLGPLSGAGFCLYVD 587 ++F + RLPKFRWD+IWLP GPLSGAG CLYVD Sbjct: 144 AIFWLYYMWRLPKFRWDIIWLPFGPLSGAGICLYVD 179 >gb|PPD83508.1| hypothetical protein GOBAR_DD19564 [Gossypium barbadense] Length = 192 Score = 61.6 bits (148), Expect = 3e-08 Identities = 25/36 (69%), Positives = 29/36 (80%) Frame = +3 Query: 480 SMFHAFLACRLPKFRWDVIWLPLGPLSGAGFCLYVD 587 ++F + R+PKFRWDVIWLPLGPL GAG CLYVD Sbjct: 134 AIFWVYYMLRMPKFRWDVIWLPLGPLCGAGVCLYVD 169 >gb|PKI51405.1| hypothetical protein CRG98_028201 [Punica granatum] Length = 198 Score = 61.6 bits (148), Expect = 3e-08 Identities = 24/36 (66%), Positives = 30/36 (83%) Frame = +3 Query: 480 SMFHAFLACRLPKFRWDVIWLPLGPLSGAGFCLYVD 587 ++F + R+P+FRWDV+WLPLGPLSGAG CLYVD Sbjct: 140 AVFWLYYMLRMPRFRWDVLWLPLGPLSGAGICLYVD 175 >ref|XP_021734566.1| uncharacterized protein LOC110701257 isoform X2 [Chenopodium quinoa] Length = 199 Score = 61.6 bits (148), Expect = 3e-08 Identities = 25/36 (69%), Positives = 29/36 (80%) Frame = +3 Query: 480 SMFHAFLACRLPKFRWDVIWLPLGPLSGAGFCLYVD 587 ++F + +LPKFRWDVIWLP GPLSGAG CLYVD Sbjct: 141 AVFWLYYMLKLPKFRWDVIWLPFGPLSGAGICLYVD 176 >ref|XP_021772530.1| uncharacterized protein LOC110736583 [Chenopodium quinoa] Length = 199 Score = 61.6 bits (148), Expect = 3e-08 Identities = 25/36 (69%), Positives = 29/36 (80%) Frame = +3 Query: 480 SMFHAFLACRLPKFRWDVIWLPLGPLSGAGFCLYVD 587 ++F + +LPKFRWDVIWLP GPLSGAG CLYVD Sbjct: 141 AVFWLYYMLKLPKFRWDVIWLPFGPLSGAGICLYVD 176 >ref|XP_016689901.1| PREDICTED: uncharacterized protein LOC107907159 [Gossypium hirsutum] Length = 206 Score = 61.6 bits (148), Expect = 3e-08 Identities = 25/36 (69%), Positives = 29/36 (80%) Frame = +3 Query: 480 SMFHAFLACRLPKFRWDVIWLPLGPLSGAGFCLYVD 587 ++F + R+PKFRWDVIWLPLGPL GAG CLYVD Sbjct: 148 AIFWVYYMLRMPKFRWDVIWLPLGPLCGAGVCLYVD 183